mariadb-client-10.11.15-150600.4.17.1<>,PiA7p9|#Uĉ1^ж+" OF i!67QAPny1,WAMLbJA7C\(6vzHuϋɝϋ~jdH< ̈́N ۿ+o_wA̵lAV}RS`= gcuT//Az9a~@ k5XVXp'I 27\ԋr?J KSIcBC+lGz>/[E:8P2>FZ?Zd ( ;tx 17?!@! ! ! H!  i!  ! l! !  ! d  <0(89 :=IBIFIGJ!HJ!IK!XK<YKTZK[K\K!]L8!^N!bNcO;dOeOfOlOuO!vP`wX4!xX!yY<TzZZZZZCmariadb-client10.11.15150600.4.17.1Client for MariaDBThis package contains the standard clients for MariaDB.iA7xinomavro8SUSE Linux Enterprise 15SUSE LLC SUSE-GPL-2.0-with-FLOSS-exceptionhttps://www.suse.com/Productivity/Databases/Clientshttps://www.mariadb.orglinuxppc64le/usr/sbin/sysusers2shadow mysql-user.conf <<"EOF" || [ -f /.buildenv ] u mysql 60 "MySQL database admin" /var/lib/mysql EOF TPQSQXRnQTHQNJ#   M))(*($1>}7`9ugAA큤iA*iA,iA,iA,iA,iA,iA,iA,iA*iA*iA*iA*iA*iA*iA*iA*iA*iA*iA,iA#!iA#!iA#!iA#!iA#!iA#!iA#!i|i|i|i|i|i|i|ff2618c4242f48e7a984cc0c95bbac507a4732f043e21f140a95cc87c26a093a6350498efd984b3e91d98457a5f3085c1bbd9aa9357bc82bc1144a57d95da4902a461730d0626d7bc0f6f98544f8eae494b9292eb481ea80ed70cbc20bbaab1e7afb3c85393163d7d597201a77fc6196871f7bf65704c3c70136a1595a203cbe0161a1493c2dc531cdfb10964ff78de186bccd15f62398e5769060c32160822f9d922bc5b636dae11e8fc1ca3a239c36d0c05eeb4da0996f0eb379aeed90b9d862380b2f2a50ded444e0ae4851097926bdef6234b5984cc26ac4d8fa974d9ac5f4f939a4be447eb7dc78218a3f94191abfc91fa728bdac662969b8906c63c9543ca8ece4659a9e724f8ff4fa607797b31d9dd45af1aa1a508127c9d8b465ceba8759f05339c7d935a7bcc983c3a984659267173df0b7819b41ca3bce148790c5e1be4318acaa2e00a39edf548e9d5ae129fa7f0dfb66ad1e63b824a6df9f03f44c2ccaa9faf36cf2867e67e2cdf1a1d8ebab0d285930b55da375ae964894a7eea7987e92c69f5547d59d33de9b4724121ceb65f3ff50c5bce5ae6b01fd0a80239c692557c1f2bd8f2e981cae9a934da46e5ac1cf8c57c728c51a53b107f334e71e18157e03db02c9b73c81ac192d173ff85a6847f601493f66f087b76855fe9032d683106781bedcbdca6c0398206fd74191991b8feb11568100b4eee81665e5e8dd90090149be367d766a5b7c37c56b305a14a4ac0429741138a026a3340b61263658e9b2231f75935c9171b3c75a6c27f42d6805137ec6b569202dbdcbee7e79396479f07a9bc83beac587fb65d112a51f04d2696f5809fe76ba8ff0b1446c463d4e95dfbd7d0ab4ed7439ce24a94289dd26a9e923e7d37ba994c3159e53dd306af69ebad50269e536088db23b2e9f33f3f9e201970664babe05be35a53255a5307037f6de37d3126304efc9766ca12aca87f4bcff9c45a17695b596c61cb51ca67bc6b7ccd8baddc0f2e2a95b3c849adbe84cfd27079bc7a6cefd2fe4b51bb214f89960ea87f3f3dd2a052f3c999aef1547c2757474c7b210c22adab597dfmariadbmariadb-adminmariadb-checkmariadbd-safe-helpermariadb-dumpmariadb-importmariadb-showrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmysqlrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmariadb-10.11.15-150600.4.17.1.src.rpmconfig(mariadb-client)group(mysql)mariadb-clientmariadb-client(ppc-64)mysql-clientuser(mysql)@@@@@@@@@@@ @@@@@@@@@     /bin/shconfig(mariadb-client)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.33)(64bit)libc.so.6(GLIBC_2.34)(64bit)libc.so.6(GLIBC_2.38)(64bit)libcrypto.so.3()(64bit)libcrypto.so.3(OPENSSL_3.0.0)(64bit)libedit.so.0()(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libmariadb3libncurses.so.6()(64bit)libncurses.so.6(NCURSEST6_5.7.20081102)(64bit)libssl.so.3()(64bit)libssl.so.3(OPENSSL_3.0.0)(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)libz.so.1()(64bit)mariadb-errormessagesrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)sysuser-shadow10.11.15-150600.4.17.13.010.11.153.0.4-14.6.0-14.0-15.2-13.2mysql-client4.14.3i$Hh@h$ffU@ee]@e@dd}@dldxc>@c`cj@cwsck@c*c pcM@bb(bw@b'E@b @a͟@a@a@aKaKaW@aba@a~@a^@a]aHwa6a@aG```KW`*b@`@`@_ǁ_#__N7_N7_3_'@^y^א^^Ǿ^@^@^v^y@^V]^U @^U @^O@^=Q@^:@^9\^9\^6^*@^,]@]@]M@]@]p]L]J@]D%]D%]9]8H@]\]@\ڭ\N\@\v{\n\j@\f\eX@\b@\-@\@\w[@[G[t[Q@[9@[[ @[M@[WZ@Z@Z@ZZ@ZH@Z$ZZaZOhZKt@Z;@ZZ@Z@YeYeY@YYcl@Y-^X@X,XpXXbWXAb@X W]NW+5V@V\:@UM@U@U@U>U@UJ@U-@U-@U@U.@T@TPT7T@TT_W@antonio.teixeira@suse.comantonio.teixeira@suse.comantonio.teixeira@suse.comantonio.teixeira@suse.comantonio.teixeira@suse.comdanilo.spinella@suse.comoss@danyspin97.orgdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.commliska@suse.czdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comchris@computersalat.dedanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.comgmbr3@opensuse.orgdanilo.spinella@suse.comdanilo.spinella@suse.comsuse-beta@cboltz.dedanilo.spinella@suse.comjsegitz@suse.comdanilo.spinella@suse.comdanilo.spinella@suse.commliska@suse.czdanilo.spinella@suse.comrpm@fthiessen.dedimstar@opensuse.orgkstreitova@suse.comkstreitova@suse.commrueckert@suse.demrueckert@suse.demrueckert@suse.dekstreitova@suse.commarec@detebe.orgcrrodriguez@opensuse.orgcrrodriguez@opensuse.orgkstreitova@suse.comdimstar@opensuse.orgguillaume.gardet@opensuse.orgpgajdos@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comidonmez@suse.commliska@suse.czkukuk@suse.comschwab@suse.depgajdos@suse.comkstreitova@suse.compgajdos@suse.comkstreitova@suse.comkstreitova@suse.commatthias.gerstner@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.compgajdos@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comstefan.bruens@rwth-aachen.dekstreitova@suse.comkstreitova@suse.comkstreitova@suse.commliska@suse.czkstreitova@suse.commatthias.gerstner@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comsuse+build@de-korte.orgrick.salevsky@suse.comtbechtold@suse.comnicolas.bock@suse.comkstreitova@suse.comkstreitova@suse.comadrian.glaubitz@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkukuk@suse.dekstreitova@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comro@suse.dersalevsky@suse.comkstreitova@suse.comdmueller@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdimstar@opensuse.orgkstreitova@suse.comrhafer@suse.devcizek@suse.comkstreitova@suse.comvcizek@suse.combwiedemann@suse.comvcizek@suse.comkstreitova@suse.comfvogt@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdimstar@opensuse.org13ilya@gmail.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comdmueller@suse.comkstreitova@suse.comkstreitova@suse.comkstreitova@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.commichal.hrusecky@opensuse.orgmichal.hrusecky@opensuse.orgdvaleev@suse.comsweet_f_a@gmx.demichal.hrusecky@opensuse.orgmgorse@suse.comxrigou@otenet.grxrigou@otenet.grmichal.hrusecky@opensuse.orgledest@gmail.com- Update to 10.11.15: https://mariadb.com/docs/release-notes/community-server/10.11/10.11.15 https://mariadb.com/docs/release-notes/community-server/changelogs/10.11/10.11.15 * fixes for the following security vulnerabilities: 10.11.15: CVE-2025-13699 (bsc#1254313) - Add %license tags to license files (bsc#1252162) - Add INSTALL_DOCREADMEDIR cmake flag to install readme and license files- Update to 10.11.14: https://mariadb.com/docs/release-notes/community-server/mariadb-10-11-series/mariadb-10.11.14-release-notes https://mariadb.com/docs/release-notes/community-server/changelogs/changelogs-mariadb-10-11-series/mariadb-10.11.14-changelog https://mariadb.com/kb/en/mariadb-10-11-13-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-13-changelog/ https://mariadb.com/kb/en/mariadb-10-11-12-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-12-changelog/ * fixes for the following security vulnerabilities: 10.11.14: none 10.11.13: none 10.11.12: CVE-2025-30722 (bsc#1249212) CVE-2025-30693 (bsc#1249213) CVE-2023-52970 (bsc#1239151) CVE-2023-52969 (bsc#1239150) CVE-2023-52971 (bsc#1249219) - Refresh gcc13-fix.patch- Update to 10.11.11: https://mariadb.com/kb/en/mariadb-10-11-11-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-11-changelog/ https://mariadb.com/kb/en/mariadb-10-11-10-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-10-changelog/ * fixes for the following security vulnerabilities: 10.11.10: none 10.11.11: CVE-2025-21490 (bsc#1243356) - Update list of skipped tests - Remove extra compiler flags. These don't seem to be needed anymore and were overwriting predefined flags - Drop unknown options- Update to 10.11.9: https://mariadb.com/kb/en/mariadb-10-11-9-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-9-changelog/ * fixes for the following security vulnerabilities: 10.11.9: none - Update list of skipped tests- Update to 10.11.8: https://mariadb.com/kb/en/mariadb-10-11-8-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-8-changelog/ * fixes for the following security vulnerabilities: 10.11.8: CVE-2024-21096 (bsc#1225983) 10.11.7: none - Refreshed patches: * mariadb-10.2.4-fortify-and-O.patch * mariadb-10.2.4-logrotate.patch * mariadb-10.4.12-fix-install-db.patch * mariadb-10.4.12-harden_setuid.patch - Update list of skipped tests- Update list of skipped tests for ppc64le- Update to 10.11.6: https://mariadb.com/kb/en/mariadb-10-11-6-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-6-changelog/ * fixes for the following security vulnerabilities: 10.11:6: CVE-2023-22084, (bsc#1217405) - Refreshed patches: * mariadb-10.4.12-fix-install-db.patch- update the list of the skipped tests for s390x, fix bsc#1215255- Update to 10.11.5: https://mariadb.com/kb/en/mariadb-10-11-5-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-5-changelog/ https://mariadb.com/kb/en/mariadb-10-11-4-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-4-changelog/ * fixes for the following security vulnerabilities: 10.11.5: none 10.11.4: none - Issues that aren't affecting this package: * CVE-2021-46669 * CVE-2022-27376 (bsc#1198628) * CVE-2022-27377 (bsc#1198603) * CVE-2022-27378 (bsc#1198604) * CVE-2022-27379 (bsc#1198605) * CVE-2022-27380 (bsc#1198606) * CVE-2022-27381 (bsc#1198607) * CVE-2022-27382 (bsc#1198609) * CVE-2022-27383 (bsc#1198610) * CVE-2022-27384 (bsc#1198611) * CVE-2022-27386 (bsc#1198612) * CVE-2022-27387 (bsc#1198613) * CVE-2022-27444 (bsc#1198634) * CVE-2022-27445 (bsc#1198629) * CVE-2022-27446 (bsc#1198630) * CVE-2022-27447 (bsc#1198631) * CVE-2022-27448 (bsc#1198632) * CVE-2022-27449 (bsc#1198633) * CVE-2022-27451 (bsc#1198639) * CVE-2022-27452 (bsc#1198640) * CVE-2022-27455 (bsc#1198638) * CVE-2022-27456 (bsc#1198635) * CVE-2022-27457 (bsc#1198636) * CVE-2022-27458 (bsc#1198637) * CVE-2022-32088 (bsc#1201168) * CVE-2022-32087 (bsc#1201167) * CVE-2022-32086 (bsc#1201166) * CVE-2022-32085 (bsc#1201165) * CVE-2022-32083 (bsc#1201163) * CVE-2022-21427 * bsc#1199928 * bsc#1195076 * jsc#SLE-22245- Skip test on s390x to fix build on ALP, bsc#1211859 - Update list of skipped tests- Refresh gcc13-fix.patch - Update to 10.11.3: * release notes and changelog: https://mariadb.com/kb/en/mariadb-10-11-3-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-3-changelog/ * fixes for the following security vulnerabilities: 10.11.3: CVE-2022-47015 (bsc#1207404)- Cherry-pick upstream changes (gcc13-fix.patch) for GCC 13.- Update to 10.11.2: * release notes and changelog: https://mariadb.com/kb/en/changes-improvements-in-mariadb-1011/ https://mariadb.com/kb/en/mariadb-10-11-2-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-2-changelog/ https://mariadb.com/kb/en/mariadb-10-11-1-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-1-changelog/ https://mariadb.com/kb/en/mariadb-10-11-0-release-notes/ https://mariadb.com/kb/en/mariadb-10-11-0-changelog/ - Refresh mariadb-10.2.4-logrotate.patch- Update to 10.10.3: https://mariadb.com/kb/en/mariadb-10-10-3-release-notes/ https://mariadb.com/kb/en/mariadb-10-10-3-changelog/ - Update mariadb.keyring- Update list of skipped tests- Update to 10.10.2: * release notes and changelog: https://mariadb.com/kb/en/changes-improvements-in-mariadb-1010/ https://mariadb.com/kb/en/mariadb-10-10-2-release-notes/ https://mariadb.com/kb/en/mariadb-10-10-2-changelog/ https://mariadb.com/kb/en/mariadb-10101-release-notes/ https://mariadb.com/kb/en/mariadb-10101-changelog/ https://mariadb.com/kb/en/mariadb-10100-release-notes/ * fixes for the following security vulnerabilities: 10.10.2: none- Update to 10.9.4: * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1094-release-notes https://mariadb.com/kb/en/library/mariadb-1094-changelog * fixes for the following security vulnerabilities: 10.9.4: none- Update to 10.9.3: * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1093-release-notes https://mariadb.com/kb/en/library/mariadb-1093-changelog- Update to 10.9.2: * changes and improvements in MariaDB 10.9: https://mariadb.com/kb/en/changes-improvements-in-mariadb-109/ * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1092-release-notes https://mariadb.com/kb/en/library/mariadb-1092-changelog https://mariadb.com/kb/en/library/mariadb-1091-release-notes https://mariadb.com/kb/en/library/mariadb-1091-changelog https://mariadb.com/kb/en/library/mariadb-1090-release-notes https://mariadb.com/kb/en/library/mariadb-1090-changelog * fixes for the following security vulnerabilities: 10.9.2: CVE-2022-32082 (bsc#1201162) CVE-2022-32089 (bsc#1201169) CVE-2022-32081 (bsc#1201161) CVE-2022-32091 (bsc#1201170) CVE-2022-32084 (bsc#1201164) CVE-2022-38791 (bsc#1202863) * The package is not affected by the following security vulnerabilities: CVE-2018-25032 (bsc#1197459) - Update list of skipped tests- Update mysql-systemd-helper to be aware of custom group, bsc#1200105 - Respect socket setting in mysql-systemd-helper - Fix my_print_defaults call in mysql-system-helper- use the better collation as default * DDEFAULT_COLLATION=utf8mb4_unicode_520_ci- Update list of skipped tests * suse_skipped_tests.list- Update to 10.8.3: * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1083-release-notes https://mariadb.com/kb/en/library/mariadb-1083-changelog https://mariadb.com/kb/en/library/mariadb-1082-release-notes https://mariadb.com/kb/en/library/mariadb-1082-changelog https://mariadb.com/kb/en/library/mariadb-1081-release-notes https://mariadb.com/kb/en/library/mariadb-1081-changelog https://mariadb.com/kb/en/library/mariadb-1080-release-notes https://mariadb.com/kb/en/library/mariadb-1080-changelog - Remove upstreamed patch: * bsc1194828.patch- Do not include mariadb-galera files in the main package when %{with galera} is false- Update to 10.7.3 (bsc#1196016): * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1073-release-notes https://mariadb.com/kb/en/library/mariadb-1073-changelog https://mariadb.com/kb/en/library/mariadb-1072-release-notes https://mariadb.com/kb/en/library/mariadb-1072-changelog https://mariadb.com/kb/en/library/mariadb-1071-release-notes https://mariadb.com/kb/en/library/mariadb-1071-changelog https://mariadb.com/kb/en/library/mariadb-1070-release-notes https://mariadb.com/kb/en/library/mariadb-1070-changelog * fixes for the following security vulnerabilities: 10.7.3: CVE-2021-46665 CVE-2021-46664 CVE-2021-46661 CVE-2021-46668 CVE-2021-46663 10.7.2: CVE-2022-24052 CVE-2022-24051 CVE-2022-24050 CVE-2022-24048 CVE-2021-46659, bsc#1195339 10.7.1: none 10.7.0: none - Remove upstreamed patches: * mariadb-10.0.15-logrotate-su.patch * mariadb-10.1.1-mysqld_multi-features.patch - Refresh mariadb-10.2.4-logrotate.patch - Update list of skipped tests - Add bsc1194828.patch to fix build with GCC12, fixes bsc#1194828 - The following issues have already been fixed in this package but weren't previously mentioned in the changes file: CVE-2021-46658, bsc#1195334 CVE-2021-46657, bsc#1195325- Build mariadb-galera on SLE - Add dependency on galera-4 for mariadb-galera - Remove old constraints for mariadb-galera- The following issues have already been fixed in this package but weren't previously mentioned in the changes file: bsc#1189320 CVE-2021-2154, bsc#1185872 CVE-2021-2166, bsc#1185870 CVE-2021-27928, bsc#1183770 MDEV-23851- Fix rpmlint errors - Run spec-cleaner- Enable LZ4 compression for INNODB and ROCKSDB, fixes bsc#1186031- Revert systemd hardening * Remove harden_mariadb.service.patch- Add CONFIG parameter to %sysusers_generate_pre- Update to 10.6.5 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1065-release-notes https://mariadb.com/kb/en/library/mariadb-1065-changelog * fixes for the following security vulnerabilities: 10.6.5: none - Not affected by [CVE-2021-35604], bsc#1192497 - Drop upstreamed patch: * mariadb-10.2.19-link-and-enable-c++11-atomics.patch- Use pam macros instead of hardcoding directories, fixes bsc#1191038 - Add fix-pamdir.patch- Add func_math_tests_MDEV-26645.diff to avoid test failures in the func_math test on Tumbleweed s390x and ppc64 until MDEV-26645 gets fixed upstream- Fix socket address in mariadb@.socket file- Added hardening to systemd service(s) (bsc#1181400). Added patch(es): * harden_mariadb.service.patch Modified: * mariadb.service.in- Replace %{_rpmconfigdir}/macros.d with %{_rpmmacrodir}, remove ownership of this directory. Fixes boo#1182218 - Run spec-cleaner- Update to 10.6.4 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1064-release-notes https://mariadb.com/kb/en/library/mariadb-1064-changelog https://mariadb.com/kb/en/library/mariadb-1063-release-notes https://mariadb.com/kb/en/library/mariadb-1063-changelog https://mariadb.com/kb/en/library/mariadb-1062-release-notes https://mariadb.com/kb/en/library/mariadb-1062-changelog https://mariadb.com/kb/en/library/mariadb-1061-release-notes https://mariadb.com/kb/en/library/mariadb-1061-changelog https://mariadb.com/kb/en/library/mariadb-1060-release-notes https://mariadb.com/kb/en/library/mariadb-1060-changelog * fixes for the following security vulnerabilities: 10.6.4: CVE-2021-2372 CVE-2021-2389 - Removed support to tokudb as it has been removed from upstream - Refresh mariadb-10.2.4-fortify-and-O.patch - Add new systemd socket from upstream- Support both rpmlint 1.x and 2.x.- Update rpmlint rules in order to work with rpmlint2 (bsc#1179049).- Update to version 10.5.10 * Fix CVE-2021-2154 * Add ST_DISTANCE_SPHERE for calculating the spherical distance between two geometries (point or multipoint) on a sphere * Fix: Crash with invalid multi-table update of view in 2nd execution of SP * Fix: Incorrect name resolution for subqueries in ON expressions * Fix: Complex query in Store procedure corrupts results * Fix: DELETE HISTORY may delete current data on system-versioned table * Fix: Crashes with nested table value constructors * Fix: Server crashes in thd_clear_errors() * Fix: The statement set password=password('') executed in PS mode fails in case it is run by a user with expired password * Full changes: https://mariadb.com/kb/en/mariadb-10510-changelog/ - Drop mariadb-10.5.9-cmake-3.20.patch, applied upstream- Add mariadb-10.5.9-cmake-3.20.patch: Fix syntax error which is exposed by cmake 3.20.- Update to 10.5.9 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1059-release-notes https://mariadb.com/kb/en/library/mariadb-1059-changelog * fixes for the following security vulnerabilities: 10.5.9: none - Tracker bug: [bsc#1182739] - Update fixes [bsc#1182255] (MDL BF-BF Conflict caused by TRUNCATE TABLE) - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - remove fix-lock-rollback-assert-abort.patch (applied upstream)- update the list of the skipped tests- exclude galera files if we build without this feature. - switch from 664 to 644 for my.cnf configuration file (probably a typo)- added fix-lock-rollback-assert-abort.patch fix an abort when a transaction is rolled back - track all patches in a series so we can easily set up a quilt tree without requiring all the devel packages- switch to bcond_with to make it easier to enable galera support via the prjconfig - fix non galera case for building- Update to 10.5.8 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-1058-release-notes https://mariadb.com/kb/en/library/mariadb-1058-changelog * fixes for the following security vulnerabilities: 10.5.7: CVE-2020-14812, CVE-2020-14765, CVE-2020-14776, CVE-2020-14789 10.5.8: none - tracker bugs: [bsc#1177472] and [bsc#1178428] - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - update suse_skipped_tests.list- update to 10.5.6 * release notes and changelog https://mariadb.com/kb/en/mariadb-1056-release-notes https://mariadb.com/kb/en/mariadb-1056-changelog * fixes for the following security vulnerabilities: 10.5.6: CVE-2020-15180 < 10.5.6: none - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch - drop mariadb-10.5-fix-prevent-optimizing-out-buf-argument-in-ch.patch - mariadb now builds against pcre2 - added binaries aria_s3_copy and mariadb-conv to tools subpackage - added type_test.type_test_double to list of skipped tests- Using basic.target dependencies is not needed with any systemd release unless DefaultDependencies is disabled, remove from unit files- Mariadb uses hrtimers with absolute CLOCK_REALTIME values, this won't work correctly if the clock isn't set and will do funny things if it goes backward after starting the server as POSIX says that the new clock value shall influence them, start the service after time-sync.target to workaround the problem.- Update to 10.4.14 [bsc#1175596] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10414-release-notes https://mariadb.com/kb/en/library/mariadb-10414-changelog * fixes for the following security vulnerabilities: none * the update fixes [bsc#1174559] and [bsc#1173516] (MariaDB crashes at db_sync from Keystone) - refresh mariadb-10.2.4-fortify-and-O.patch - fix patch sequence - run spec-cleaner - build galera for openSUSE only - update suse_skipped_tests.list - tune the testsuite to avoid randomly failing tests- Fix installed .service files to follow the /usr/lib -> /usr/libexec move (boo#1174811).- Update _constraints to make it more readable and request more memory for aarch64 to avoid occasionnal OOM errors on %check- rpm macros: $TEST_USER identified by $TEST_PASS is actually user of the database for which client conf should be made for - rpm macros: database name or names can be specified as a %mysql_testserver_start and %mysql_testserver_cconf parameter - modified sources % macros.mariadb-test- Build with oqgraph by default for all codestreams [jsc#SLE-12253]- Update to 10.4.13 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10413-release-notes https://mariadb.com/kb/en/library/mariadb-10413-changelog * fixes for the following security vulnerabilities: CVE-2020-2752, CVE-2020-2812, CVE-2020-2814, CVE-2020-2760, CVE-2020-13249 - fixes [bsc#1168380] (the same as [bsc#1166781]) MDEV-21244 mysql_upgrade creating empty global_priv table support upgrades from 5.2 privilege tables - drop specfile "hacks" as things work correctly in upstream now: * renaming tmpfiles.conf -> mariadb.conf * installing pam_user_map.so to /lib64/security for non 32bit architectures * sysusers.conf was renamed to mariadb.conf - update suse_skipped_tests.list- move mariadb-client-test from client subpackage to test subpackage so the symlink from mariadb-client-test -> mysql_client_test works [bsc#1170204]- Add oqgraph.social to the suse_skipped_tests.list (reported upstream as MDEV-22280) [bsc#1169369]- Add -Wl,-Bsymbolic -Wl,-Bsymbolic-functions to linker flags so that symbols are resolved locally if possible, this will avoid https://bugs.kde.org/show_bug.cgi?id=391362- Add mariadb-10.5-fix-prevent-optimizing-out-buf-argument-in-ch.patch in order to fix boo#1158405 (MDEV-21248).- Cleanup mysql user creation/handling and use sysusers.d- Bump disk constraint to 18Gb- test macros: clarify who is admin and user of the database, fix build with 10.4 - modified sources % macros.mariadb-test- remove @VERSION@ from mariadb.service and mariadb@.service- disable testing with rpm macros as it does not work as for 10.4, needs to be investigated- update suse_skipped_tests.list for ppc- rename mariadb.rpmlintrc to mariadb-rpmlintrc - for ppc install pam_user_map.so in /lib/security- rename mariadb-10.2.12-harden_setuid.patch to mariadb-10.4.12-harden_setuid.patch to match the correct version number. - add mariadb-10.4.12-fix-install-db.patch to improve default behaviour of mysql_install_db. This prevents performing security sensitive actions to be performed but instead only warns the caller (bsc#1160868).- update to 10.4.12 [jsc#SLE-8269] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10412-release-notes https://mariadb.com/kb/en/library/mariadb-10412-changelog https://mariadb.com/kb/en/library/mariadb-10411-release-notes https://mariadb.com/kb/en/library/mariadb-10411-changelog * fixes for the following security vulnerabilities: CVE-2020-2574 * don't let mysql_install_db set SUID bit for auth_pam_tool in rpm/deb packages CVE-2020-7221 [bsc#1160868] - add mariadb-10.2.12-harden_setuid.patch to harden auth_pam_tool setuid-root binary [bsc#1160285] - pack pam_user_map.so module in the /%{_lib}/security directory and user_map.conf configuration file in the /etc/security directory - fix race condition with mysql_upgrade_info status file by moving it to the location owned by root (/var/lib/misc) CVE-2019-18901 [bsc#1160895] - move .run-mysql_upgrade file from $datadir/.run-mysql_upgrade to /var/lib/misc/.mariadb_run_upgrade so the mysql user can't use it for a symlink attack [bsc#1160912] - change -DWITH_COMMENT and -DCOMPILATION_COMMENT to be SUSE/openSUSE independent- enhance mariadb.service and mariadb@.service with various options (Documentation=, User=, Group=, KillSignal=, SendSIGKILL=, Restart=, RestartSec=, CapabilityBoundingSet=, ProtectSystem=, ProtectHome=, PermissionsStartOnly= and UMask=) [bsc#1160878] - mysql-systemd-helper: use systemd-tmpfiles instead of shell script operations for a cleaner and safer creating of /run/mysql [bsc#1160883]- update to 10.4.10 * changes and improvements for 10.4 https://mariadb.com/kb/en/changes-improvements-in-mariadb-104/ * fixes for the following security vulnerabilities: none - pack mariadb variants of the mysql binaries (e.g. mariadb-dumpslow is a symlink to mysqldumpslow and the like) - refresh mariadb-10.2.4-fortify-and-O.patch - update suse_skipped_tests.list - _constraints: increase physicalmemory value - package auth_pam_tool setuid binary properly - add cracklib-password-check subpackage but do not build it right now (cracklib-dict-full >= 2.9.0 is not available yet) - add rcmariadb compat link - add mariadb.rpmlintrc file - do not move my_safe_process to bindir but use rpmlint arch-dependent-file-in-usr-share exception for it (this file is used just for the testing and it doesn't have to be in bindir- added rpm test macros: %mysql_testserver_start, %mysql_testserver_cconf, %mysql_testserver_stop First two consuments are python-sortinghat and python-mysqlclient.- update the list of the skipped tests- update to 10.3.20 * notable changes for 10.3.20 * MDEV-20987: InnoDB fails to start when FTS table has FK relation * notable changes for 10.3.19 * MDEV-20864: Debug-only option innodb_change_buffer_dump for dumping the contents of the InnoDB change buffer to the server error log at startup. * MariaBackup: * MDEV-18438: mbstream recreates xtrabackup_info on same directory as backup file * MDEV-20703: mariabackup creates binlog files in serve binlog directory on --prepare --export step * FULLTEXT INDEX: * MDEV-19647: Server hangs after dropping full text indexes and restart * MDEV-19529: InnoDB hang on DROP FULLTEXT INDEX * MDEV-19073: FTS row mismatch after crash recovery * MDEV-20621: FULLTEXT INDEX activity causes InnoDB hang * MDEV-20927: Duplicate key with auto increment * ALTER TABLE: * MDEV-20799: DROP Virtual Column crash * MDEV-20852: BtrBulk is unnecessarily holding dict_index_t::lock * System-Versioned Tables: * MDEV-16210: FK constraints on versioned tables use historical rows, which may cause constraint violation * MDEV-20812: Unexpected ER_ROW_IS_REFERENCED_2 or server crash in row_ins_foreign_report_err upon DELETE from versioned table with FK * Galera wsrep library updated to 25.3.28 * Fixes for the following security vulnerabilities: CVE-2019-2974, CVE-2019-2938 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10320-release-notes https://mariadb.com/kb/en/library/mariadb-10320-changelog https://mariadb.com/kb/en/library/mariadb-10319-release-notes https://mariadb.com/kb/en/library/mariadb-10319-changelog - remove mariadb-10.3.17-fix_ppc_build.patch (applied upstream) - refresh * mariadb-10.2.4-logrotate.patch * mariadb-10.0.15-logrotate-su.patch- update to 10.3.18 * notable changes * Connect updated to Connect 1.06.0010 * MDEV-20066: This bug could cause a table to become corrupt if a column was added instantly * MDEV-15326: A race condition in InnoDB transaction commit that affects record locking was fixed * MDEV-17187: Table doesn't exist in engine after ALTER of FOREIGN KEY * MDEV-20301: InnoDB's MVCC has O(N^2) behaviors * MDEV-18128: Simplify .ibd file creation * MDEV-20060: Failing assertion: srv_log_file_size <= 512ULL << 30 while preparing backup * MDEV-20247: Replication hangs with "preparing" and never starts * MDEV-17614: Remove unnecessary locking for INSERT...ON DUPLICATE KEY UPDATE * MDEV-20311: row_ins_step accesses uninitialized memory * MDEV-19947: Repositories for RHEL 8 ppc64le added * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10318-release-notes https://mariadb.com/kb/en/library/mariadb-10318-changelog- Use instead of for _constraints, increasing the worker pool on x86_64 from 6 to >700.- remove sql_mode from my.ini/my.cnf as NO_ENGINE_SUBSTITUTION and STRICT_TRANS_TABLES are already set by default from version 10.2.4 [bsc#1144314]- add mariadb-10.3.17-fix_ppc_build.patch to fix a compilation failure for ppc if ${CRC32_LIBRARY} target has no COMPILE_FLAGS yet. Then GET_TARGET_PROPERTY returns COMPILE_FLAGS-NOTFOUND, which doesn't work very well when it's later fed back into COMPILE_FLAGS. - _constraints: increase the memory because of the ppc build - adjust mysql-systemd-helper ("shutdown protected MySQL" section) so it checks both ping response and the pid in a process list as it can take some time till the process is terminated. Otherwise it can lead to "found left-over process" situation when regular mariadb is started [bsc#1143215]- update to 10.3.17 [bsc#1141798] * notable changes: * MDEV-19795: Merge upstream MyRocks. * MDEV-17228: Encrypted temporary tables are not encrypted. * MDEV-18328: Disks Plugin is now stable and requires the FILE privilege. * Merge relevant InnoDB changes from MySQL 5.7.27 * Adjust spin loops to the x86 PAUSE instruction latency * CREATE TABLE: MDEV-19292, MDEV-20102 * ALTER TABLE: MDEV-15641, MDEV-19630, MDEV-19916, MDEV-19974 * Indexed virtual columns: MDEV-16222, MDEV-17005, MDEV-19870 * FULLTEXT INDEX: MDEV-14154 * Encryption: MDEV-17228, MDEV-19914 * Galera + FOREIGN KEY: MDEV-19660 * Recovery & Mariabackup: MDEV-19978 * MDEV-19781: Add page id matching check in innochecksum tool * MDEV-20091: DROP TEMPORARY table is logged despite no CREATE was logged * MDEV-19427: mysql_upgrade_service throws exception upgrading from 10.0 to 10.3 * MDEV-19814: Server crash in row_upd_del_mark_clust_rec or Assertion * MDEV-17363: Compressed columns cannot be restored from dump * fixes for the following security vulnerabilities: CVE-2019-2805, CVE-2019-2740, CVE-2019-2739, CVE-2019-2737, CVE-2019-2758 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10317-release-notes https://mariadb.com/kb/en/library/mariadb-10317-changelog - add "BuildRequires: python3" as some tests and myrocks_hotbackup script need python3. Make the PYTHON_SHEBANG value configurable [bsc#1142909] - remove "innodb_file_format" option from my.ini (my.cnf) file that was removed in MariaDB 10.3.1. Also remove "innodb_file_per_table=ON" option that is by default ON and it's redundant now. - remove mariadb-10.2.9-galera_cnf.patch as it's not clear what the correct path to galera wsrep provider is while users can use galera 3, galera 4 or galera compiled on their own - add "Requires: python3-mysqlclient" that is needed by myrocks_hotbackup script- Use FAT LTO objects in order to provide proper static library.- remove client_ed25519.so plugin because it's shipped in mariadb-connector-c package (libmariadb_plugins)- removal of SuSEfirewall2 service, since SuSEfirewall2 has been replaced by firewalld, see [1]. [1]: https://lists.opensuse.org/opensuse-factory/2019-01/msg00490.html- update to 10.3.16 [bsc#1108088] * notable changes: * MDEV-19490: show tables fails when selecting the information_schema database * MDEV-19491: multi-update with triggers and stored routines * MDEV-19541: InnoDB crashes when trying to recover a corrupted page * MDEV-19725: Incorrect error handling in ALTER TABLE * MDEV-19445: FULLTEXT INDEX fix * MDEV-19486: System Versioning fix * MDEV-19509: InnoDB skips the tablespace in rotation list * MDEV-19614: SET GLOBAL innodb_ deadlock due to LOCK_global_system_variables * MDEV-17458: Unable to start galera node * MDEV-17456: Malicious SUPER user can possibly change audit log configuration without leaving traces * MDEV-19588: Wrong results from query, using left join * MDEV-19258: RIGHT JOIN hangs in MariaDB * Virtual columns fixes: MDEV-19027, MDEV-19602 * Crash recovery fixes: MDEV-13080, MDEV-19587, MDEV-19435 * MDEV-11094: Fixed row-based event applying with an error anymore when the events aim at the blackhole engine and row annotation is enabled * MDEV-19076: Fixed slave_parallel_mode=optimistic did not always properly order replication events on temporary tables in some case to attempt execution before a parent event has been already processed * MDEV-19158: Fixed duplicated entries in binlog occurred in combination of LOCK TABLES and binlog_format=MIXED when a being locked table was under replication unsafe operation * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10316-release-notes https://mariadb.com/kb/en/library/mariadb-10316-changelog - fix reading options for multiple instances if my${INSTANCE}.cnf is used. Also remove "umask 077" from mysql-systemd-helper that causes that new datadirs are created with wrong permissions. Set correct permissions for files created by us (mysql_upgrade_info, .run-mysql_upgrade) [bsc#1132666] - remove mariadb-5.5.28-install_db-quiet.patch and add "--rpm" option to the mysql_install_db script that does basically the same [bsc#1080891] - remove mariadb-10.1.12-deharcode-libdir.patch because it's not needed - we don't build libmariadb library in mariadb package anymore so we don't need to take care about LIBDIR and PLUGINDIR here. Moreover we shouldn't (and we don't) touch *_RPM variables as they are internal) [bsc#1080891] - update suse_skipped_tests.list- update to 10.3.15 * see changes in 10.3 series https://mariadb.com/kb/en/library/changes-improvements-in-mariadb-103/ * fixes for the following security vulnerabilities: [CVE-2019-2503] (the rest was already applied for 10.2) - remove mysql-community-server-5.1.45-multi-configuration.patch as we have the same configuration in /etc/my.cnf and it doesn't make any sense to keep it twice. Moreover the patched file support-files/my-medium.cnf.sh was removed in upstream - remove mariadb-5.2.3-cnf.patch as all patched files were removed upstream - refresh mariadb-10.2.4-fortify-and-O.patch - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch and use a simplified version from Debian - refresh README.install and suse-test-run - remove caching_sha2_password.so as it's shipped in mariadb-connector-c package (libmariadb_plugins) - rename libmysqld subpackage (embedded library) to libmariadbd as libmysqld.so was renamed to libmariadbd.so (MDEV-14953) - simplify removing static libs (we don't need to have .static) - add perl(Memoize) and perl(Symbol) to BuildRequires and Requires that are needed for tests - replace Requires pwdutils with shadow - build RocksDB only for x86_64 as other platforms are not supported - remove xtrabackup scripts as we already removed xtrabackup requires and it doesn't work for MariaDB 10.3 anyway - run spec-cleaner - tracker bugs for version updates in between: * 10.2.25 tracker bug [bsc#1136035] * 10.2.29 tracker bug [bsc#1156669]- update to 10.2.24 GA [bsc#1122198] * notable changes: * MDEV-18968 - Both (WHERE 0.1) and (WHERE NOT 0.1) return empty set * MDEV-18466 - Unsafe to log updates on tables referenced by foreign keys with triggers in statement format * MDEV-18899 - Server crashes in Field::set_warning_truncated_wrong_value * MDEV-18298 - Crashes server with segfault during role grants * MDEV-17610 - Unexpected connection abort after certain operations from within stored procedure * MDEV-19112 - WITH clause does not work with information_schema as default database * MDEV-17830 - Server crashes in Item_null_result::field_type upon SELECT with CHARSET(date) and ROLLUP * MDEV-14041 - Server crashes in String::length on queries with functions and ROLLUP * MDEV-18920 - Prepared statements with st_convexhull hang and eat 100% cpu. * MDEV-15837 - Assertion item1->type() == Item::FIELD_ITEM && item2->type() == Item::FIELD_ITEM * MDEV-9531 - GROUP_CONCAT with ORDER BY inside takes a lot of memory while it's executed * MDEV-17036 - BULK with replace doesn't take the first parameter in account * Bug#28986737 - RENAMING AND REPLACING MYSQL.USER TABLE CAN LEAD TO A SERVER CRASH * MDEV-19350 - Server crashes in delete_tree_element / ... / Item_func_group_concat::repack_tree * MDEV-19188 - Server Crash When Using a Trigger With A Number of Virtual Columns on INSERT/UPDATE * MDEV-19352 - Server crash in alloc_histograms_for_table_share upon query from information schema InnoDB * InnoDB persistent corruption fixes: MDEV-19426, MDEV-19022, MDEV-19241, MDEV-13942 * InnoDB recovery fixes and speedup: MDEV-18733, MDEV-12699, MDEV-19356, MDEV-19426 * MDEV-14398 - innodb_encrypt_tables will work even with innodb_encryption_rotate_key_age=0 * MDEV-17036 - BULK with replace doesn't take the first parameter in account * MDEV-14784 - Slave crashes in show_status_array upon running a trigger with select from I_S * MDEV-19060 - mariabackup continues, despite failing to open a tablespace * MDEV-18686 - Add option to PAM authentication plugin to allow case insensitive username matching * bugfix - multi-update checked privileges on views incorrectly * MDEV-19276 - during connect, write error log warning for ER_DBACCESS_DENIED_ERROR, if log_warnings > 1 * MDEV-17456 - Malicious SUPER user can possibly change audit log configuration without leaving traces. * fixes for the following security vulnerabilities: [CVE-2019-2614], [CVE-2019-2627], [CVE-2019-2628] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10224-release-notes https://mariadb.com/kb/en/library/mariadb-10224-changelog - refresh mariadb-10.2.19-link-and-enable-c++11-atomics.patch- remove %{extra_provides} definition and Provides/Obsoletes where it was used. It's just a remnant and it's no longer needed.- update to 10.2.23 GA * notable changes: * InnoDB ALTER TABLE fixes: MDEV-18016, MDEV-18630, MDEV-18775, MDEV-18732, MDEV-18749, MDEV-18637, MDEV-13818, MDEV-17595 * MDEV-18878: InnoDB Purge: Optimize away futile table lookups * MDEV-14984: Regression in connect performance * MDEV-18936: Purge thread fails to exit on shutdown * MDEV-18272: InnoDB fails to rollback after exceeding FOREIGN KEY recursion depth * MDEV-9519: Data corruption on Galera cluster size change * MDEV-18204: fix incremental MyRocks backup * MDEV-18611: mariabackup terminated while copying InnoDB redo log * MDEV-18669: mariabackup writes timestamp in version line * MDEV-18855: Mariabackup should fetch innodb_compression_level from running server * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10223-release-notes https://mariadb.com/kb/en/library/mariadb-10223-changelog - remove mariadb-10.2.22-fix_path.patch that is no longer needed (applied upstream)- add mariadb-10.2.22-fix_path.patch to fix a path to resolveip in mysql_install_db script [bsc#1127027] MDEV-18526- my.cnf/my.ini: move slow_query_log example to the error log so it's logically together- fix references path below legacy directory /var/run -> /run- remove xtrabackup requirement as MariaDB ships a build in mariabackup so xtrabackup is not needed unless a user specificaly wants to use xtrabackup as sst method (also solves [bsc#1122475]- add slow_query_log example to my.cnf and adjust the logrotate configuration to rotate all /var/log/mysql/*.log files . This is useful when the slow query log is enabled. In that case, this log file should also be rotated (bsc#1112767)- update to 10.2.22 GA * notable changes: * Backport Information Schema CHECK_CONSTRAINTS Table. * MDEV-17475: Maximum value of table_definition_cache is now 2097152 * InnoDB ALTER TABLE fixes: MDEV-16499, MDEV-18186, MDEV-18237, MDEV-18222, MDEV-18256, MDEV-18016, MDEV-16849 * Mariabackup fixes: MDEV-18185, MDEV-18201, MDEV-18194 * Galera crash recovery fix: MDEV-15740 * Encryption fixes: MDEV-18129, MDEV-18183, MDEV-18279 * Fixes for the following security vulnerabilities: * CVE-2019-2510, CVE-2019-2537 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10222-release-notes https://mariadb.com/kb/en/library/mariadb-10222-changelog- update to 10.2.21 GA * notable changes: * MDEV-17589 - Stack-buffer-overflow with indexed varchar (utf8) field * MDEV-16987 - ALTER DATABASE possible in read-only mode (forbid ALTER DATABASE in read_only) * MDEV-17720 - slave_ddl_exec_mode=IDEMPOTENT does not handle DROP DATABASE * MDEV-6453 - Assertion `inited==NONE || (inited==RND && scan)' failed in handler::ha_rnd_init(bool) with InnoDB, joins, AND/OR conditions * MDEV-18105 - Mariabackup fails to copy encrypted InnoDB system tablespace if LSN>4G * MDEV-18041 - Database corruption after renaming a prefix-indexed column [bsc#1120041] * MDEV-17470 - Orphan temporary files after interrupted ALTER cause InnoDB: Operating system error number 17 and eventual fatal error 71 * MDEV-17833: ALTER TABLE is not enforcing prefix index size limit * MDEV-17989: InnoDB: Failing assertion: dict_tf2_is_valid(flags, flags2) * MDEV-17765: Locking bug fix for SPATIAL INDEX * MDEV-17923, MDEV-17904, MDEV-17938: Fixes for FULLTEXT INDEX * Fixes for regressions introduced in MariaDB Server 10.2.19 by the backup-safe TRUNCATE TABLE (MDEV-13564, innodb_safe_truncate=ON) and innodb_undo_log_truncate: * MDEV-17780, MDEV-17816, MDEV-17849, MDEV-17851, MDEV-17885 * Several improvements to MariaDB Server and backup for dealing with encrypted or page_compressed pages: * MDEV-12112: corruption in encrypted table may be overlooked * MDEV-17958: On little-endian systems, remove bug-compatible variant of innodb_checksum_algorithm=crc32 * MDEV-17957: Make innodb_checksum_algorithm stricter for strict_* values * MDEV-18025: Mariabackup fails to detect corrupted page_compressed=1 tables * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10221-release-notes https://mariadb.com/kb/en/library/mariadb-10221-changelog https://mariadb.com/kb/en/library/mariadb-10220-release-notes https://mariadb.com/kb/en/library/mariadb-10220-changelog - update suse_skipped_tests.list- remove PerconaFT from the package as it has AGPL licence [bsc#1118754] - use a new syntax for cmake variables that specify which plugin will be built- Add patch to link against libatomic where necessary and use C++11 atomics instead of gcc built-in atomics * mariadb-10.2.19-link-and-enable-c++11-atomics.patch - Add two tests to suse_skipped_tests.list for ppc * encryption.innodb-bad-key-change2 * encryption.innodb-bad-key-change4- update to 10.2.19 GA [bsc#1116686] * notable changes: * innodb_safe_truncate system variable for a backup-safe TRUNCATE TABLE implementation that is based on RENAME, CREATE, DROP (MDEV-14717, MDEV-14585, MDEV-13564). Default value for this variable is ON. If you absolutely must use XtraBackup instead of Mariabackup, you can set it to OFF and restart the server * MDEV-17289: Multi-pass recovery fails to apply some redo log records * MDEV-17073: INSERT…ON DUPLICATE KEY UPDATE became more deadlock-prone * MDEV-17491: micro optimize page_id_t * MDEV-13671: InnoDB should use case-insensitive column name comparisons like the rest of the server * Fixes for indexed virtual columns: MDEV-17215, MDEV-16980 * MDEV-17433: Allow InnoDB start up with empty ib_logfile0 from mariabackup --prepare * MDEV-12547: InnoDB FULLTEXT index has too strict innodb_ft_result_cache_limit max limit * MDEV-17541: KILL QUERY during lock wait in FOREIGN KEY check causes hang * MDEV-17531: Crash in RENAME TABLE with FOREIGN KEY and FULLTEXT INDEX * MDEV-17532: Performance_schema reports wrong directory for the temporary files of ALTER TABLE…ALGORITHM=INPLACE * MDEV-17545: Predicate lock for SPATIAL INDEX should lock non-matching record * MDEV-17546: SPATIAL INDEX should not be allowed for FOREIGN KEY * MDEV-17548: Incorrect access to off-page column for indexed virtual column * MDEV-12023: Assertion failure sym_node->table != NULL on startup * MDEV-17230: encryption_key_id from alter is ignored by encryption threads * fixes for the following security vulnerabilities: CVE-2018-3282 [bsc#1112432], CVE-2016-9843 [bsc#1013882], CVE-2018-3174 [bsc#1112368], CVE-2018-3143 [bsc#1112421], CVE-2018-3156 [bsc#1112417], CVE-2018-3251 [bsc#1112397], CVE-2018-3185 [bsc#1112384], CVE-2018-3277 [bsc#1112391], CVE-2018-3162 [bsc#1112415], CVE-2018-3173 [bsc#1112386], CVE-2018-3200 [bsc#1112404], CVE-2018-3284 [bsc#1112377] * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10219-release-notes https://mariadb.com/kb/en/library/mariadb-10219-changelog - do not pack libmariadb.pc (packed in mariadb-connector-c)- add "Requires: libmariadb_plugins" to the mariadb-test subpackage in order to be able to test client plugins successfuly [bsc#1111859] - don't remove debug_key_management.so anymore [bsc#1111858]- update to 10.2.18 GA * notable changes: * MDEV-15511 - if available, stunnel can be used during Galera rsync SST * MDEV-16791 - mariabackup: Support DDL commands during backup * MDEV-13564 - Refuse MLOG_TRUNCATE in mariabackup * MDEV-16934 - add new system variable eq_range_index_dive_limit to speed up queries that new long nested IN lists. The default value, for backward compatibility, is 0 meaning "unlimited". * MDEV-13333 - errors on InnoDB lock conflict * Report all InnoDB redo log corruption * MDEV-17043 - Purge of indexed virtual columns may cause hang on table-rebuilding DDL * MDEV-16868 - corruption of InnoDB temporary tables * MDEV-16465 - Invalid (old?) table or database name or hang in ha_innobase::delete_table and log semaphore wait upon concurrent DDL with foreign keys * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10218-release-notes https://mariadb.com/kb/en/library/mariadb-10218-changelog - refresh mariadb-10.2.4-fortify-and-O.patch- add ssl tests that are failing with OpenSSL 1.1.1 to suse_skipped_tests.list [MDEV-17184]- update to 10.2.17 GA * notable changes: * New variable innodb_log_optimize_ddl for avoiding delay due to page flushing and allowing concurrent backup * InnoDB updated to 5.7.23 * MDEV-14637 - Fix hang due to DDL with FOREIGN KEY or persistent statistics * MDEV-15953 - Alter InnoDB Partitioned Table Moves Files (which were originally not in the datadir) to the datadir * MDEV-16515 - InnoDB: Failing assertion: ++retries < 10000 in file dict0dict.cc line 2737 * MDEV-16809 - Allow full redo logging for ALTER TABLE * Temporary tables: MDEV-16713 - InnoDB hang with repeating log entry * indexed virtual columns: MDEV-15855 - Deadlock between purge thread and DDL statement * MDEV-16664 - Change the default to innodb_lock_schedule_algorithm=fcfs * Galera: MDEV-15822 - WSREP: BF lock wait long for trx * fixes for the following security vulnerabilities: CVE-2018-3064 [bsc#1103342], CVE-2018-3063 [bsc#1101677], CVE-2018-3058 [bsc#1101676], CVE-2018-3066 [bsc#1101678], CVE-2018-3060 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10217-release-notes https://mariadb.com/kb/en/library/mariadb-10217-changelog- switch to libedit as control sequences were already fixed there so we don't have to avoid it [bsc#1098683]- update to 10.2.16 GA * notable changes: * MDEV-13122: mariabackup now supports MyRocks * MDEV-13779 - InnoDB fails to shut down purge workers, causing hang * MDEV-16267 - Wrong INFORMATION_SCHEMA.INNODB_BUFFER_PAGE.\ TABLE_NAME * MDEV-13834 - Upgrade failure from 10.1 innodb_encrypt_log * MDEV-16283 - ALTER TABLE...DISCARD TABLESPACE still takes long on a large buffer pool * MDEV-16376 - ASAN: heap-use-after-free in gcol.innodb_virtual_debug * MDEV-15824 - innodb_defragment=ON trumps innodb_optimize_fulltext_only=ON in OPTIMIZE TABLE * MDEV-16124 - fil_rename_tablespace() times out and crashes server during table-rebuilding ALTER TABLE * MDEV-16416 - Crash on IMPORT TABLESPACE of a ROW_FORMAT=COMPRESSED table * MDEV-16456 - InnoDB error "returned OS error 71" complains about wrong path * MDEV-13103 - Deal with page_compressed page corruption * MDEV-16496 - Mariabackup: Implement --verbose option to instrument InnoDB log apply * MDEV-16087 - Inconsistent SELECT results when query cache is enabled * MDEV-15114 - ASAN heap-use-after-free in mem_heap_dup or dfield_data_is_binary_equal (fix for indexed virtual columns) * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10216-release-notes https://mariadb.com/kb/en/library/mariadb-10216-changelog - refresh mariadb-5.5.28-install_db-quiet.patch - refresh mariadb-10.2.9-galera_cnf.patch - pack wsrep_sst_rsync_wan file to galera subpackage - update suse_skipped_tests.list- Don't require systemd explicit, spec file can handle both cases correct and in containers we don't have systemd.- update to 10.2.15 GA * notable changes: * PCRE updated to 8.42 * The embedded server library now supports SSL when connecting to remote servers [bsc#1088681], [CVE-2018-2767] * MDEV-15325 - Incomplete validation of missing tablespace during recovery * MDEV-15720 - ib_buffer_pool unnecessarily includes the temporary tablespace * MDEV-15764 - InnoDB may write uninitialized garbage to redo log * MDEV-15553 - Virtual Columns: Assertion failed in dict_table_get_col_name * MDEV-14705 - slow innodb startup/shutdown can exceed systemd timeout * MDEV-15507 - Assertion failed in dict_check_sys_tables on upgrade from 5.5 * MDEV-15916 - Change buffer crash during TRUNCATE or DROP TABLE * encryption fixes - MDEV-12632, MDEV-13516, MDEV-15752, MDEV-15566, MDEV-16092 * temporary table ROLLBACK fixes - MDEV-15826, MDEV-15374 * applicable changes from 5.7.22 - MDEV-16142 * fixes for the following security vulnerabilities: CVE-2018-2786, CVE-2018-2759, CVE-2018-2777, CVE-2018-2810, CVE-2018-2782, CVE-2018-2784, CVE-2018-2787, CVE-2018-2766, CVE-2018-2755, CVE-2018-2819, CVE-2018-2817, CVE-2018-2761, CVE-2018-2781, CVE-2018-2771, CVE-2018-2813 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10215-release-notes https://mariadb.com/kb/en/library/mariadb-10215-changelog - update suse_skipped_tests.list and add tests that are failing with GCC 8 [bsc#1092544], MDEV-16127 - do not build TokuDB as a build without jemalloc is not supported upstream- update suse_skipped_tests.list and add failing tests for s390- update to 10.2.14 GA * notable changes: * MyRocks is now Gamma (RC) * MDEV-14533 - Added the DISKS plugin, for monitoring disk space * MDEV-14611 - ALTER TABLE EXCHANGE PARTITION does not work properly when used with DATA DIRECTORY. * MDEV-15333 - MariaDB (still) slow start * MDEV-12255 - Wrong result with innodb_prefix_index_cluster_optimization * MDEV-12396 - IMPORT TABLESPACE cleanup * MDEV-14648 - Restore fix for MySQL BUG#39053 - UNINSTALL PLUGIN does not allow the storage engine to cleanup open connections * MDEV-15249 - IMPORT fixes * MDEV-14988 - innodb_read_only tries to modify files if transactions were recovered in COMMITTED state * MDEV-14773 - DROP TABLE hangs for InnoDB table with FULLTEXT index (fixing a recent regression from upstream) * MDEV-15529 - IMPORT TABLESPACE unnecessarily uses the doublewrite buffer * MDEV-15554 - InnoDB page_cleaner shutdown sometimes hangs * MDEV-14545 - Mariabackup - Backup fails due to MLOG_INDEX_LOAD record * fixes for the following security vulnerabilities: none * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10214-release-notes https://mariadb.com/kb/en/library/mariadb-10214-changelog - remove the following patches * mariadb-10.2.14-xtrabackup-v2.patch (applied upstream, MDEV-15254) * mariadb-10.2.13-aarch_compilefix.patch (applied upstream, MDEV-14318) * mariadb-10.2.10-disable_openssl_compatibility_check.patch (fixed upstream in https://github.com/MariaDB/server/pull/558) * mariadb-10.2.8-systemd-cmake.patch and DWITH_SYSTEMD=ON compile option that are no longer needed - systemd is detected correctly now (discussed in [bsc#1080891] and MDEV-8379) * mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch (fixed upstream in 52516706c86f9f66c76836eabde7e2477694bac3) * remove mariadb-10.2.3-group.patch that was just a half solution of the group support (missing server part) and moreover using a group option in mysql-systemd-helper was removed few years ago as it caused troubles because MariaDB resolved it as 'group_concat_max_len option' (see https://github.com/openSUSE/mysql-packaging/issues/15) - remove jar files from the tarball (used for testing from the source) - build TokuDB without the jemalloc support for now. Jemalloc 5 is not backwards compatible which leads to the errors in the testsuite at least (MDEV-15034) - update suse_skipped_tests.list- change %{extra_provides} macro from "mariadb_102" to "mariadb-102" and use this macro in Provides/Obsoletes for mariadb, test, tools, bench and errormessages subpackages to ensure a smooth transition from SLE12 to SLE15 [fate#323756] - remove "Provides: mariadb-errormessages = 10.1.25" that shouldn't be needed anymore- fix build on aarch64: compile a few more files with -O0 from https://jira.mariadb.org/browse/MDEV-14318 add patch mariadb-10.2.13-aarch_compilefix.patch- add mariadb-10.2.14-xtrabackup-v2.patch (bsc#1083087)- update to 10.2.13 GA * notable changes * InnoDB updated to 5.7.21 * Galera wsrep library updated to 25.3.23 * MDEV-13869 - MariaDB slow start * MDEV-14611 - ALTER TABLE EXCHANGE PARTITION does not work properly when used with DATA DIRECTORY * MDEV-15249 - Crash in MVCC read after IMPORT TABLESPACE * Foreign key bugs: * MDEV-15199 - Referential integrity broken in ON DELETE CASCADE/MDEV-14222 Unnecessary 'cascade' memory allocation for every updated row * MDEV-15219 - FOREIGN KEY CASCADE or SET NULL operations will not resume after lock wait * MDEV-15042 - INSERT ON DUPLICATE KEY UPDATE produces error 1032 (Can't find record) * MDEV-13205 - InnoDB: Failing assertion: !dict_index_is_online_ddl(index) upon ALTER TABLE * MDEV-14958 - Merge new release of InnoDB MySQL 5.7.21 to 10.2 * MDEV-15165 - InnoDB purge for index on virtual column is trying to access an incomplete record * MDEV-15143 - InnoDB: Rollback of trx with id 0 completed * MDEV-11415 - Remove excessive undo logging during ALTER TABLE…ALGORITHM=COPY * MDEV-15016 - multiple page cleaner threads use a lot of CPU * MDEV-14941 - Timeouts on persistent statistics tables caused by MDEV-14511 * MDEV-14985 - innodb_undo_log_truncate may be blocked if transactions were recovered at startup * MDEV-14441 - InnoDB hangs when setting innodb_adaptive_hash_index=OFF during UPDATE * MDEV-14887 - On a 32-bit system, MariaDB 10.2 mishandles data file sizes exceeding 4GiB * fixes for the following security vulnerabilities: * CVE-2018-2562, CVE-2018-2622, CVE-2018-2640, CVE-2018-2665, CVE-2018-2668, CVE-2018-2612 * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10213-release-notes/ https://mariadb.com/kb/en/library/mariadb-10213-changelog/ * fixes [bsc#1058729] and [bsc#1068906] - refresh mariadb-10.2.10-disable_openssl_compatibility_check.patch - refresh mariadb-10.2.3-group.patch- add dependency on which for galera scripts- change owner of mysql-test directory from root to mysql. It also fixes sys_vars.secure_file_priv running under mysql user (e.g. if ít's started via suse-test-run script) that needs to be able to create a test file there during its run [bsc#1012075]- update to 10.2.12 GA * release notes and changelog: https://mariadb.com/kb/en/library/mariadb-10212-release-notes/ https://mariadb.com/kb/en/library/mariadb-10212-changelog/ - remove mysql-community-server-5.5.6-safe-process-in-bin.patch becuase this moving is done in the specfile - get rid of the archive with patches (remove mysql-patches.tar.xz and series files), handle patches in the standard way mysql-community-server-5.1.45-multi-configuration.patch mariadb-10.2.4-logrotate.patch mariadb-5.5.28-install_db-quiet.patch mariadb-10.1.1-mysqld_multi-features.patch mariadb-5.2.3-cnf.patch mariadb-10.2.3-group.patch mariadb-10.1.12-deharcode-libdir.patch mariadb-10.0.15-logrotate-su.patch mariadb-10.2.4-fortify-and-O.patch mariadb-10.2.8-systemd-cmake.patch mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch mariadb-10.2.9-galera_cnf.patch mariadb-10.2.10-disable_openssl_compatibility_check.patch - add comments to the section with removing unused files (based on https://lists.launchpad.net/maria-developers/msg11028.html) - put rm statements together - install the new upstream systemd-tmpfiles configuration file 'tmpfiles.conf' and rename it to 'mariadb.conf' in order to follow the manual - remove the new upstream systemd-sysusers configuration file as we handle creating of mysql user in the specfile - mysql.service: remove calling of the wait function and let systemd to do this job. Switch from 'Type=simple' to 'Type=notify' and add TimeoutSec=300 - rename unit files from mysql to mariadb and add mysql alias for the backward compatibility [bsc#1067443] * mysql.service -> mariadb.service * mysql.target -> mariadb.target * mysql@.service -> mariadb@.service - remove configuration-tweaks.tar.xz and move configuration to my.ini/my.cnf file (omit default_plugins.cnf as all configuration here was commented out) - add a numeric prefix for galera.cnf file in order to allow users to speficy in which order the configs will be loaded within the my.cnf.d directory [bsc#1055268] - add 'bind-address = 127.0.0.1' as a default option to my.cnf file for security reasons (disable MariaDB to listen for TCP/IP connections by default) [bsc#1058374] - update my.cnf file and add a section with SSL configuration [bsc#1058374]- switch from deprecated 'net-tools' to 'iproute2' for mariadb-galera subpackage. This dependency switch is sufficient for making wsrep_sst_rsync.sh script to use 'ip' instead of 'ifconfig' command- Do not manually delete %{_localstatedir}/adm/update-messages/%{name}-%{version}-%{release}-something: The file is listed as ghost and thus properly owned by the package. - Use %tmpfiles_create which can cope with transactional updates.- update to 10.2.11 GA * release notes and changelog: * https://mariadb.com/kb/en/library/mariadb-10211-release-notes/ * https://mariadb.com/kb/en/library/mariadb-10211-changelog/ - pack additional mroonga/groonga files - change default charset to utf8mb4 for full Unicode support [fate#324329] - remove mariadb-10.2.10-wsrep_sst_common.patch as it's no longer needed- Added mariadb-10.2.10-wsrep_sst_common.patch (bsc#1069401). Upstream bug: https://jira.mariadb.org/browse/MDEV-14256- Disable openssl compatibility checking * the check uses CRYPTO_set_mem_functions() to set debugging memory allocation function. The setting only succeeds if no allocation was done before. Our fips self-tests, which are run from the library constructor, however, do allocate memory, so the subsequent call to CRYPTO_set_mem_functions causes the compatibility check to fail * add mariadb-10.2.10-disable_openssl_compatibility_check.patch- update to 10.2.10 GA * release notes and changelogs https://downloads.mariadb.org/mariadb/+releases/ * fixes for the following security vulnerabilities * 10.2.10: CVE-2017-10378, CVE-2017-10268, CVE-2017-15365 * 10.2.8: CVE-2017-3636, CVE-2017-3641, CVE-2017-3653, CVE-2017-10320, CVE-2017-10365, CVE-2017-10379, CVE-2017-10384, CVE-2017-10286, CVE-2017-3257 * 10.2.6: CVE-2017-3308, CVE-2017-3309, CVE-2017-3453, CVE-2017-3456, CVE-2017-3464 * 10.2.5: CVE-2017-3313, CVE-2017-3302 * [bsc#1042632], [bsc#1043328], [bsc#1019948], [fate#323738] - refresh and rename the following patches: * mariadb-10.1.4-group.patch to mariadb-10.2.3-group.patch * mariadb-10.1.16-systemd-cmake.patch to mariadb-10.2.8-systemd-cmake.patch * mariadb-10.1.18-mysql_install_db-mariadb_dirs.patch to mariadb-10.2.3-mysql_install_db-mariadb_dirs.patch * mariadb-10.1.12-fortify-and-O.patch to mariadb-10.2.4-fortify-and-O.patch * mysql-community-server-5.1.46-logrotate.patch to mariadb-10.2.4-logrotate.patch - add mariadb-10.2.10.tar.gz.sig signature and mariadb.keyring files - start building without client library part, use mariadb-connector-c for getting libmariadb libraries. Remove libmysclient* packages - remove baselibs.conf because we no longer build client libraries here - update %{soname} to 19 (libmysqld soname) - change '=' to '>=' in Requires:mariadb-errormessages for libmysqld%{soname}. Versioned libraries shouldn't require regular packages with '='. It also causes problems during update (Problem: libmysqld18-10.1.25-3.1.x86_64 requires mariadb-errormessages = 10.1.25, but this requirement cannot be provided). Also add "Provides: mariadb-errormessages = 10.1.25" for errormessages subpackage that solves this problem for the current update. - pack new files, remove mysql specific files - remove README.SUSE as it was outdated - package cleaning * run spec-cleaner * renumber sources * reorganize subpackages order and update summaries, descriptions and groups * tweak and add some comments to the specfile * remove warning about mysql-packaging repository that is no longer used for this package * remove checks whether we build mysql or mariadb (we build mariadb only) - add galera subpackage * add missing "Requires:" (lsof, net-tools, rsync, socat, xtrabackup) for proper wsrep scripts functionality * add mariadb-10.2.9-galera_cnf.patch that enhances galera.cnf configuration file (add wsrep_on=OFF and set the location of the wsrep library) * rename README-wsrep to README.wsrep so it corresponds with the other README names * move galera_new_cluster, galera_recovery, use_galera_new_cluster.conf, wsrep_* scripts to the galera subpackage - remove the following macros definitions: * %{_tmpfilesdir} - it's been defined in systemd macros since openSUSE 13.2 * %{preferred} - we no longer need to distinguish between preferred and not preferred version (we build mariadb only) * %{with_mandatory_lz4} - mysql specific * %{build_extras}, %{pretty_name}, %{build_readline}, %{builtin_plugins} and {libname} - they are no longer needed - add the following macros * %{run_testsuite} macro that controls the run of the regression testsuite * %{ignore_testsuite_result} macro - when set to 1 it ignores results from the regression testsuite (debug purposes) * %{with_mroonga} macro (enable mroonga build for x86_64 archs only) - rename %{with_jemalloc} to %{with_tokudb} and enable tokudb for x86_64 architectures for openSUSE and SLE15 [fate#323280]. Don't enable it for SLE12 (missing jemalloc dependency) - add the following BuildRequires: * unixODBC-devel to allow ODBC support for Connect engine [bsc#1039034] * krb5-devel to build auth_gssapi.so plugin * libarchive-devel * use libboost_headers-devel instead of boost-devel for TW. Boost package has been split up and will migrate to using multibuild. This results in packages that unnecessarily build require boost-devel to cause major bottlenecks [bsc#1062583] - do not use "BuildRequires: lzo-devel" for i586 and arm because it makes build fail - add the following Requires: * hostname - as mariadb_install_db depends on this tool [bsc#1060110] * libaio-devel for libmysqld-devel because libmysqld depends on libaio - tweak build options: * remove "DWITH_ASAN=OFF" - this option was added because of mysql and it's no longer needed * switch from "-DWITH_JEMALLOC=auto" to "-DWITH_JEMALLOC=system" * use "DCMAKE_SKIP_INSTALL_RPATH" - this allows to link with -rpath during build and fixes quite a few test suite failures. When installing the file -rpath is still disabled, so this should not have any effect on the installed binaries * add "-DWITH_LIBARCHIVE=ON" and "-DWITH_MARIABACKUP=ON" * remove -DWITH_BOOST=../boost/ as we use system boost now - enable OQGRAPH to build (openSUSE only, SLE is missing Judy requirement) - disable Cassandra storage engine build as it's no longer actively being developed (See MDEV-4695) [bsc#1055165] * Remove "BuildRequires: libthrift-devel" and %{with_cassandra} macros that are no longer needed now - disable make test (Connector/C unit tests) as it requires a running server. These tests are part of mysql-test-run now (MDEV-12470) - add suse_skipped_tests.list - the list of the tests that we want to skip (they fail correctly or the fix is in progress) * adjust mysql-test-run options to skip tests listed there [bsc#1041891] - remove mytop utility that is packaged separately - remove *.jar files from mysql-test - remove python scripts remains from tokudb upstream - remove generating of the MySQL NDB Cluster filelists - remove removing of manpages for MySQL Carrier Grade Edition - provide a symlink for the my_safe_process executable that was moved from its location to bindir - update filename in /var/adm/update-messages to match documentation and build-compare pattern - README is now README.md - fix "file listed twice" build error- Also Require: libopenssl-1_0_0-devel from the libmysqlclient-devel package- Drop INFO_BIN from package because it is not needed and differs for every build (boo#1047218)- Explicitly require libopenssl-1_0_0-devel, to successfully build once we switch openssl to 1.1 (bsc#1042632)- update to MariaDB 10.1.25 GA * notable changes * MariaDB can no longer be compiled with OpenSSL version 0.9.8 and below. The last 0.9.8 release was in December 2015, it is out of support and is no longer getting security fixes. * MariaDB Backup is now beta * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10125-release-notes * https://mariadb.com/kb/en/mariadb/mariadb-10125-changelog * refresh mariadb-10.1.12-fortify-and-O.patch * remove mariadb-10.1.22-xtradb_null_checks.patch (MDEV-12358), a fix was merged upstream * update file lists for new man-pages and tools - switch from 'Restart=on-failure' to 'Restart=on-abort' in mysql.service in order to follow the upstream- Add mariadb-10.1.22-xtradb_null_checks.patch (boo#1041525) (See also https://jira.mariadb.org/browse/MDEV-12358) - switch from '/var/run' to '/run' as /var/run is just a symlink to /run - fix permissions for /var/run/mysql that were wrongly set to 700 instead of 755 due to added umask. This prevented non-root from connecting to the database [bsc#1038740] - change permissions of the configuration dir/files to 755/644. Please note that storing the password in the /etc/my.cnf file is not safe. Use for example an option file that is accessible only by yourself [bsc#889126] - set the default umask to 077 in mysql-systemd-helper [bsc#1020976]- increase required physical memory in _constraints from 5 GB to 7 GB in order to try to fix i586 build that fails because of "Out of memory" error- update to MariaDB 10.1.22 GA * notable changes * XtraDB updated to 5.6.35-80.0 * TokuDB updated to 5.6.35-80.0 * PCRE updated to 8.40 * MDEV-12160: ed25519 authentication plugin * MDEV-11842: Fix a 10.1.21 regression with failed INSERT, BEFORE INSERT triggers, and columns with no default value * MDEV-12075: Fix a 10.1.21 regression in the InnoDB data file extension code * MDEV-11027: better InnoDB crash recovery progress reporting * MDEV-11520: improvements to how InnoDB data files are extended * Improvements to InnoDB startup/shutdown to make it more robust * MDEV-11233: fix for FULLTEXT index crash * MDEV-9734: systemd compatible bintar files now available * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10122-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10122-changelog/ * fixes the following CVEs: * CVE-2017-3313 [bsc#1020890], CVE-2017-3302 [bsc#1022428] - refresh mysql-community-server-5.1.46-logrotate.patch - refresh mariadb-10.1.16-systemd-cmake.patch - remove mariadb-10.1.20-incorrect_list_handling.patch that is no longer needed [bsc#1022428] [CVE-2017-3302]- update to MariaDB 10.1.21 * notable changes: * Innodb updated to 5.6.35 * Performance Schema updated to 5.6.35 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10121-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10121-changelog/ * fixes the following CVEs: CVE-2017-3318 [bsc#1020896], CVE-2017-3317 [bsc#1020894], CVE-2017-3312 [bsc#1020873], CVE-2017-3291 [bsc#1020884], CVE-2017-3265 [bsc#1020885], CVE-2017-3258 [bsc#1020875], CVE-2017-3257 [bsc#1020878], CVE-2017-3244 [bsc#1020877], CVE-2017-3243 [bsc#1020891], CVE-2017-3238 [bsc#1020882], CVE-2016-6664 [bsc#1008253] - add mariadb.te file to the filelist - add mysqld_safe_helper to the filelist - refresh mariadb-10.1.4-group.patch - add mariadb-10.1.20-incorrect_list_handling.patch to fix incorrect linked list handling in mysql_prune_stmt_list() function that can cause use-after-free error [bsc#1022428]- Replace systemd and systemd-devel BuildRequires with pkgconfig(libsystemd), which matches what the build system is actually looking for.- update to MariaDB 10.1.20 * notable changes: * XtraDB updated to 5.6.34-79.1 * TokuDB updated to 5.6.34-79.1 * HeidiSQL updated to 9.4 * The limit for the table_open_cache system variable has been increased to 1024K * Galera wsrep library updated to 25.3.19 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10120-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10120-changelog/- update to MariaDB 10.1.19 * notable changes: * XtraDB updated to 5.6.33-79.0 * TokuDB updated to 5.6.33-79.0 * release notes and changelog: * https://mariadb.com/kb/en/mariadb/mariadb-10119-release-notes/ * https://mariadb.com/kb/en/mariadb/mariadb-10119-changelog/ * fixes for the following security vulnerabilities: CVE-2016-7440 [bsc#1005581] CVE-2016-5584 [bsc#1005558] - add mariadb-10.1.18-mysql_install_db-mariadb_dirs.patch to fix mysql_install_db.sh script to find data files in mariadb directories when a user uses "--basedir" option [bsc#1006539] - switch to xz compression instead of bz2 for the following tarballs: * mysql-patches.tar.bz2 renamed to mysql-patches.tar.xz * configuration-tweaks.tar.bz2 renamed to configuration-tweaks.tar.xz replace occurrences of "bzip2" with "xz" in README.debug- update to 10.1.18 * Release notes: https://mariadb.com/kb/en/mariadb/mariadb-10118-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10117-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10116-release-notes/ https://mariadb.com/kb/en/mariadb/mariadb-10115-release-notes/ * Changelog: https://mariadb.com/kb/en/mariadb/mariadb-10118-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10117-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10116-changelog/ https://mariadb.com/kb/en/mariadb/mariadb-10115-changelog/ * fixed CVE's: CVE-2016-8283, CVE-2016-6663, CVE-2016-5629, CVE-2016-5626, CVE-2016-5624, CVE-2016-5616, CVE-2016-3492, CVE-2016-6662, CVE-2016-5440, CVE-2016-3615, CVE-2016-3521, CVE-2016-3477 * fix: [bsc#1005582], [bsc#1001367], [bsc#1005569], [bsc#1005566], [bsc#1005564], [bsc#1005562], [bsc#1005555], [bnc#998309], [bsc#989926], [bsc#989922], [bsc#989919], [bsc#989913] * refresh mariadb-10.1.4-group.patch * refresh mariadb-10.1.12-fortify-and-O.patch - requires devel packages for aio and lzo2 - remove mariadb-10.0.21-mysql-test_main_bootstrap.patch that is no longer needed [bnc#984858] - append "--ignore-db-dir=lost+found" to the mysqld options in "mysql-systemd-helper" script if "lost+found" directory is found in $datadir [bnc#986251] - remove syslog.target from *.service files [bsc#983938] - add BuildRequires: systemd-devel - make some dependecies switchable - add systemd to deps to build on leap and friends - add mariadb-10.1.16-systemd-cmake.patch to allow more (case-insensitive) values for 'WITH_SYSTEMD' variable in systemd.cmake - replace '%{_libexecdir}/systemd/system' with %{_unitdir} macro - remove useless mysql@default.service [bsc#971456] - replace all occurrences of the string "@sysconfdir@" with "/etc" in mysql-community-server-5.1.46-logrotate.patch as it wasn't expanded properly [bsc#990890]- update to 10.1.14 * What is MariadDB 10.1: https://mariadb.com/kb/en/mariadb/what-is-mariadb-101/ * CVEs fixed in 10.1.x branch CVE-2016-2047, CVE-2016-0668, CVE-2016-0651, CVE-2016-0650, CVE-2016-0649, CVE-2016-0646, CVE-2016-0644, CVE-2016-0642, CVE-2016-0641, CVE-2016-0640, CVE-2016-0616, CVE-2016-0610, CVE-2016-0609, CVE-2016-0608, CVE-2016-0606, CVE-2016-0600, CVE-2016-0598, CVE-2016-0597, CVE-2016-0596, CVE-2016-0546, CVE-2016-0505, CVE-2015-7744, CVE-2015-4913, CVE-2015-4895, CVE-2015-4879, CVE-2015-4870, CVE-2015-4866, CVE-2015-4864, CVE-2015-4861, CVE-2015-4858, CVE-2015-4836, CVE-2015-4830, CVE-2015-4826, CVE-2015-4819, CVE-2015-4816, CVE-2015-4815, CVE-2015-4807, CVE-2015-4802, CVE-2015-4792 * adjust mysql-patches.tar.bz2 archive for mariadb-101 * pack new MariaDB 10.1.x files - remove '%define _rundir' as 13.1 is out of support scope - temporarily disable OQGraph It seems to need the boost library with the version not earlier than 1.40 and not later than 1.55 (MDEV-9479) - add "BuildRequires: systemd-devel" for SLE12, openSUSE 13.2 and openSUSE Leap in order to enable systemd features during the build of mariadb-101 for these products. Otherwise we get "Performing Test HAVE_SYSTEMD - Failed" and systemd files aren't installed. - re-enable profiling support - don't remove HandlerSocket plugin [bnc#979524] - add 'log-error' and 'secure-file-priv' configuration options (added via configuration-tweaks.tar.bz2) [bsc#963810] * add '/etc/my.cnf.d/error_log.conf' that specifies 'log-error = /var/log/mysql/mysqld.log'. If no path is set, the error log is written to '/var/lib/mysql/$HOSTNAME.err', which is not picked up by logrotate. * add '/etc/my.cnf.d/secure_file_priv.conf' which specifies that 'LOAD DATA', 'SELECT ... INTO' and 'LOAD FILE()' will only work with files in the directory specified by 'secure-file-priv' option (='/var/lib/mysql-files'). - run 'usermod -g mysql mysql' only if mysql user is not in mysql group. Run 'usermod -s /bin/false/ mysql' only if mysql user doesn't have '/bin/false' shell set. - don't delete the log data when migration fails- fix constraints conditions for 32bit architectures- fix information leak via mysql-systemd-helper script [CVE-2015-5969], [bnc#957174]- update to 10.0.22 * Release notes: https://kb.askmonty.org/en/mariadb-10022-release-notes/ * Changelog: https://kb.askmonty.org/en/mariadb-10022-changelog/ * fixed CVEs: CVE-2015-4802, CVE-2015-4807, CVE-2015-4815, CVE-2015-4826 CVE-2015-4830, CVE-2015-4836, CVE-2015-4858, CVE-2015-4861 CVE-2015-4870, CVE-2015-4913, CVE-2015-4792 * remove the following patches (applied upstream) * mysql-community-server-5.6.12-srv_buf_size.patch * mariadb-10.0.16-header_files_const_warnings.patch - add mariadb-10.0.21-mysql-test_main_bootstrap.patch that fix main.bootstrap test (change default charset to utf8 in test result) [bnc#937787] - add mariadb-10.0.22-fix_build_denabled_profiling_off.patch to fix compilation with '-DENABLED_PROFILING=OFF'- update to MariaDB 10.0.21 * changes: * https://mariadb.com/kb/en/mariadb/mariadb-10021-release-notes * the following patches were processed upstream and are no longer needed: * mariadb-5.5.28-hotcopy.patch * mariadb-5.1.50-strncat-overflow.patch * mysql-community-server-5.1.51-mysql_config.patch * mariadb-5.5.32-upgrade-exit-status.patch * mariadb-5.5.41-mariadb-admincrash.patch - use syntax in mysql-systemd-helper that is accepted by both mariadb and mysql [bnc#937767] - fix spurious macro expansion in comment in specfile - install INFO_BIN and INFO_SRC, noticed in MDEV-6912 - replace readline-devel for readline5-devel (MDEV-6912) [bnc#902396] - use spec-cleaner - Tweak some cmake switches to enable more things * WITH_ASAN=OFF adress sanitization WITH_LIBWRAP=ON tcp wrappers ENABLED_PROFILING=OFF profiling disable (for mysql) ENABLE_DEBUG_SYNC=OFF debug testing sync disable (for mysql) WITH_PIC=ON by default we want pic generated binaries (for mysql) - set cmake options for MariaDB Galera Cluster - remove superfluous '--group' parameter from mysql-systemd-helper - make -devel package installable in the presence of LibreSSL - cleanup after the update-message if it was displayed - add 'exec' to mysql-systemd-helper to shutdown mysql/mariadb cleanly [bnc#943096] - remove redundant entry from %{_tmpfilesdir}/mysql.conf. Using both 'x' and 'X' options is redundant and causes a warning message. Leaving only the 'x' line fixes this problem. [bnc#942908]- Sync to git state, fixes bnc#937754 too- Sync to git state fixing few triv issues- Enable testsuite- Update to 10.0.20: https://mariadb.com/kb/en/mariadb/mariadb-10020-release-notes/ * Fixes bnc#934789 Logjam Attack using 512bit dh groups in ssl - Sync the package to git state, redoing initscripts to be more robust- Update to 10.0.19, sync to git state of repository: https://mariadb.com/kb/en/mariadb/mariadb-10019-release-notes/- fix parent directory has insecure permissions error- disable optional features for mariadb * still possible to use them from mariadb_100 package- Adjust _constraints. 11GB is not enough for ppc64 builds, increase to 13GB- fix build for openSUSE 13.2 ppc bnc#921955- Updated to the version 10.0.17 * Release notes: http://kb.askmonty.org/v/mariadb-10017-release-notes * Changelog: http://kb.askmonty.org/v/mariadb-10017-changelog - merged patches to packaging git and regenerated * few fixes mainly to upgrades- README.SuSE is now README.SUSE; fix name in some places.- Fix undefined initial status in systemd script (boo #914370)- Fix include dir in alternative cnf files (bnc #859345)- run spec cleaner on spec - update to 10.0.15 * Release notes: http://kb.askmonty.org/v/mariadb-10015-release-notes * Changelog: http://kb.askmonty.org/v/mariadb-10015-changelog - conditionally enable more storage engines - updated packaging to the latest templates- fix bashism in posttrans script/bin/shmysql-clientxinomavro 1765881848  !10.11.15-150600.4.17.110.11.15-150600.4.17.110.11.15-150600.4.17.110.11.1510.11.15mysqlaccess.confmariadbmariadb-adminmariadb-checkmariadb-dumpmariadb-importmariadb-showmariadbd-safe-helpermysqlmysqladminmysqlcheckmysqld_safe_helpermysqldumpmysqlimportmysqlshowmysql-user.confmysqlplugindialog_examples.somariadb-admin.1.gzmariadb-check.1.gzmariadb-dump.1.gzmariadb-import.1.gzmariadb-show.1.gzmariadb.1.gzmariadbd-safe-helper.1.gzmysql.1.gzmysqladmin.1.gzmysqlcheck.1.gzmysqld_safe_helper.1.gzmysqldump.1.gzmysqlimport.1.gzmysqlshow.1.gz/etc//usr/bin//usr/lib/sysusers.d//usr/lib64//usr/lib64/mysql//usr/lib64/mysql/plugin//usr/share/man/man1/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:42002/SUSE_SLE-15-SP6_Update/bdff19329776e62fab659ddc88cc1f45-mariadb.SUSE_SLE-15-SP6_Updatedrpmxz5ppc64le-suse-linux ASCII textELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=342c7c515533b4b91c32698bd4808e76a9645d4f, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=fd81d221a42d822c67fcb8f0573b464d79eee841, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=5cc1220526292d5b9612b77ec0e345f3d706a0cd, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=3d18b1275156e5ee70b208e31f24889e0815d6d6, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=99fb35bffe444a43c43a59e082c460c89bb41ea9, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=46e07958e6f50ac0baf41483f53e2081ac244382, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=70071eed5398447a5adc8bb41579d5ab91f77aea, for GNU/Linux 4.3.0, strippeddirectoryELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=4540f6c64c7461ea8fbad6320e938cb339574068, strippedtroff or preprocessor input, ASCII text, with no line terminators (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)*5@KPR R RRRR RRRRRRR RRRRRRR RR RRRRRRRRRRR RRRRRRRRRRR RRRRRRRRRRR RRRRRRRRRRR RRRRRRRRRRRRRRRPPRR G9kV.Qutf-88dae833755b226fc796844f30c4830b571bd446818a8645b2a26351a0d78c8d0?7zXZ !t/ ]"k% ASDui0o%@?pξ؎;c އQp9c"ӵ@K䊵o!EGzEy JP:KI2Q@=h|SCG 4(g y.rf.u#OIu_ \,Jn_4F{;)=Q7)#ra:gtKEړS֤R<KJoAƚ/L =8cdlݎ,b1Bma(E?XN Tsne.ߺ`jT$ǧ|I2zMjE;=a$# ЕW)O2+1K<𨑩`GqL_1&!KrN2C~W9/&we "f6l 4sMJ=iK?V2?:|2Z"]L^"i| CMnO3r&SܐVN2OOAݟ j~_WA *0cߋFbDC,Wê.k7M9!! Gs*|=n2/&wX8pw͓T{66BlqpkN'ZmSaAe-bO%΢/Fp\/zl[2Sjl/u¾Wa ./:AaIP= bPJ2mU(:WW?!vJ(61C, é` \_[(ۍӛ@iP@qeUp#ȸ=jEd#wӨ0anORϿEVn܄+)!=0+U|/i5Ď7HkWWlA!\rwLWRi,#v"oӊ5p,8ʞ{on _ݨA\vUA'EV7(Vdu0Cz |USq؆tECa%K}P's#X^=AA|G[^_yۉ s/TQW@KyEB`Z5_tz\7~[m7rޏ7NdF0?DbyJ̓4 pLxkbnzVƦnև:R,d99nOhڴ|p9@wf?h) 3Rϕ}Y[2?`Ƨj=ہ'~+B<(R?>g;[I/f,+:H|6p]tCUdYٓBi6YYe~GZ~9iw|.;Q!W*iA[܍8Q٥9G剼YD@n\P"y^a d5wʬ'5Y{TXDVa!c2PdHbDZJ%kڍ"|'#^-&M@㊔cʹ$@'#vLjn`IiNJl]|>#7`f8L4Q6'`61O@ PES%*K*];85AʾՔ$qT>p.$j q":jBa(R?J\%oS?3jooU8a2k`0 ZjT3ծDnRD0"䰿.5Èv=i1g<.l,t~2TG#Y\/!K6:oiFn ˇWTSSVk#peH iDWM՞Ozc#bQY{ RvhQvJM{B%{~_WO0u sq7|8hUGwBlϹ{`RSrl}Ex;꿒œ 炷-̦8pQ}\ ʖ\+~OL06_6h_)ivyrEzS@s3XQ9䰙>V<`|@! B)OUj&(~ƨT$jM[u>ҐT@fQ M _]pUT8=%,ְCVfĄP;|nT$ h<#z=du vv}3O?$RzP0{-XgozUNhV *B=9r[y*i52 eEحAX;E2K5h+qJ?l).wCh~'.TZu#@?~mD{yW'ah ~%ߋ>ci%m5;usoĪKҳEWmG<">7@I/]Ǯrd]]&_Euu0uGr;Vikgʥ2ҟ]Z(gX5hjX$FUz7/KE|v#9jx0?ga楄x~96SE]̼2;mX;Rkuj\\]M_y"ݩb{+8 &5[?!BI;,h"\[3= 3ޡ^# +ri'ƿJ9~J\79>,J> g SLp ux7Z ߹/-9/fsȿ29- ȭG'}37hϑt!%vu[-&f8&_4P-x3}w(3-mgC0+AT@8`!JzHn.."OBx +p#\Nn.k3kJ?| (,~ @.|gGjOg;m=" kd/ϘO'TR؈⬟]Qgy7@έ5a# qmRlW:{OȭoScE(M/34(oZkHLij Vl@ɌZp,O~^PkGJ0)\fx^:ځ[V̡ZmH&2ZׄI>%}K 1XhchJ$eC-  L.DU(15|TNDD[bĢbl(-+eZeup' ¤-]Ìl@V7Z$JLOnA"12u v,rF/:'WtϪV1}"Neyss;9 P4D_2i4U/Kb'NؔQ4^vJ a|2ikK3;];I>Ȕ?'3bJ S.{{*S\9J弖Z@u<<&w˰+*s}E%feQ?TB]Jy5|wLؕ!De[=;Zcpp߽^<>remz^}+?r9=_첢 +XSFϻ`n҅ܦm%%JAwbpOEJ8 CU |?+~ BTbR[TJ_Jei@sG,ZreCZ; j;KmÈp$W@ΡτO-o@\M\oaPϡlM/_ yi>oR@@510"wpHIKj嫉P~܈PSBxb+O)a(@-bV1YџGP1eO0f@w"?.Tab9}2RO-bV4?/E{HcZ,=L} R*p.nxAEz팓@kM4y_^Hc#̙εQgowx(iPA?z!\{Z"eݢOf6W9 ̋ S~XpofRI8<}aلOٰQ.ixFot)*.dM۱h )J[K@QKt_a@dPrrdFmڨOp! Br.R ayĢf*8cJq#9p&>|$m>,iƸ43[_w"#/+ /4=U4Zi{f`|1{҉73-%JP( gh1lYVW ܛkEz{C]К3D@X2?^`Vd[^trB.C3Q \eC dROժJF398BNBuֵmH5/T3^Q0RD .IK{Q'o@P,L侱\t ]֌`~(2{fc>G˗C?.^4u_U&=| sVj8LUY oex.MN o|ZύS8v8H#*y iI^pH'8U[4m2W:Ә*d]9 gЕ121 J8w[|)lmV $-mPcԲew\+z.<лRAB11%\=NE} J` ZJ*)+L#G6R҂Tٕ`tG,+KhW3aN5 ݒH90O 2Y[?NT@H̀%c>R燶W(oWosY1j9zUc0J M.}`_ṇ=X[Y(cDif,|,}$zON(=YkmgqE̚ǵi,3'_&7tE P5]ܦqFb_ۙ"KXz/++<uBr,(* G9^J~p&i͈m`r^5A[Nu{H.ɢ`]bILNt F:ەݒ7"a([9-m}Cݹ&"UOmz̖S&A Kew2cS&>g5X'Z"|YhSwݢI2I=ǿ巆\?>ȍw;-2>Ȫ.AT-)g^EM0ݦ Idžha~S1+ +zT(6m?j<W$ &,ޑ.DaSY%L:`s(SGjɴvDrSd68$_ܭ/\ {:P% -ߚqß&L \"P^< 0b$jCx8Ѯ[ *]d>qaJ:ߋӻ:俴X2H$ϝN1g xwM&Fcf뼔SPNr4 X/}[mPy-.Amg/*oV[R ڈ)yCՠxH},sW2W4)-HXp)ZSkpZGQY6Smu^o 'x:@؄)DKCd"UCIf/5[x,L (ٝL ҟ:Go%dhv>p({UY?7B mW2}Ua6Z/F1Υ'7Nvk+JxkElke,gjBָƴO0h=.ma@[v=n2 !O+O!CbOkETV ʼnv!eY' cHS/5rb,ࣖ-95ZzCUk s|ʋq=CqVn5=!g*['X{I2R+Y잆]!]͎<-Ys_1eWN;-Ֆ횐ѥ[czl9M%igĄ8Y.ulR:aHf*y_EYg&l[^I:wqq'<0{wDxiMs6&vKn)x&L?q O0Iϡ)E U+.A{7OFnJ=LCUE4tnA1*3hQ8ٝcJP@ $הT*#WKنڌ0Mj O1{璉 z2bWH~^#gN/ȡ $둹fgt4U WW D v\ D;cIvƚOx*|FX'uE)TVtS;CQAϋNnj<{[ԁ, kZ^N}V&'1Q :;'\rB@la1*'*w0#pacȐ6f0ge_pJֈ,KRpc ;\/ݎp޴[%k158':duZyK"6EPù^/ء,M&Ţ!35AaJHuds!Fh =vgf=bjnk\oGn(Q9YdL(Ya:qb.fxۈ>.N¥'0'R}:+ [HI[D[KHʓ_LTy)ܵTQp̀ܙgs6XK~>^0YhDeX ޹/1:so>_f-x#^Ep4x|D@ӭ0U(oR2]Ȗ0ҔI6fH1&1H _ ^y&l.mkA_FYQHʴګK~ns..7OY,[dN1:&@OB dTO) AUC$yn2C@@QfbŁxE-[ZGyUMJ6+s)J~ʹT%5с8)A;e~‘ _lqBp6^9MdN=/4drV?C ~H 0_o["_o2shH] (W`۳FŸdӌ`XZw2\ԃ]Xhv03(T`cw}{!aןx QGf^] zddX,1aRjE{|դ~Q¾ ,jF/ζHe`Jj)2c3E? 8w8$m҂Eq[7J4{뉰 bδ(Ӕ0>[jWU>2,otY 1_(t@Vlf3H&!(W(qB5!RM|UYCMC=0ŋj TGS9CUAq q I+ F]Wl(uE* a[֎BƻݠTIʊ"wtQFLjKW`q+[ B"#=7˾vo J"҉&La?}ǍDLRPן5Emn.j mu˩"&>B=+мU#bHh*'?n8wHl ǒC"I!)uNզ>iqGx:º??FiYJ &x7> ChzcCnQnKOL*@<%I?hYr &՟o-p"&7 +LKڛDL1rRd\|ok0#h) WS^A:4 By.^TFMrD6^&tJGKsd /ȫpQd~{g5*_(Z0du1hۼ;|VԻA#$fq]wS׀-0'z5ΐ9@31l|eIWYޑga!d5Ƃ#x`dcnvAA?X_ocF$O)NQGMOFX$Gz p2޵In6ϧ?T_\s{2_nZ q#`&W2+DN+y_`iv ܝ)n)"ˠe3 SB|Ny|sOCEoAn#9Ts#[A,% 'uS4zefQ뙹@Lj6!WEÓMyE4"fò@P ngeGLp?E͒FM/8;c}\KyAp#qzѴݗIYbsVp OxHqIev %N*!5mKcZ+1@J7+)^|DP$QY=35?>4 *M-gz+Q[k Rч1@8]XRwoP{5e#57g"e4w H|;Xa28`[ *ӑem;'ۡ+YS|[wtͨdgېČ]|}ݿU]O9;3v1?Z:qgLBf'YFcYjXEZN[#ņD9&6|Cb8X V^  Ԯ/~?D40RA%m\㵃]uPG,exs=l~ӎM2 z;mɮf6./.ذagUϫ{8tgo.7eXK.R'E* ֆ͌*mRwcw *Rdx]9\܅#e*pDEceov2̼rvGL^f6g'$ j/x`tgm^!ic4׏ ϰmd0z`j0{#zl5 Mv pKM)z&!/5$K)&U>j#*=\XH ?,`GcR%CI"TNFV˴m|< Vna6wJ9zRm;s"W/GQF,ܻb:։r6tW&tƁS/ZNxt$)CH6cGOo[eU7Q}n^D2{wnID+2SKhyG;o5J0~l|E !1]NF!I>\W!N*ʞ]̡?8FՆmbtG7|l%SV9j+%&OQfwA<3 y2e-r \^g87Sc#9 ?9OsI.)N}8TtNGF6kdޖI;P EV3jOOuL,瀝R̀yhѪAs,ݍ<8ED4e{04/^F[lS\;F:hl+J0&m鬅Æ(E豱񭝞 B) ? ) XByG A4J-=F6$8S0D4aD&5;@Jw1rSZD &й? D[T~ kT5zYN^ƽ-&EW9}:mlRvj{; [ GȟCj m/FY\|xj@-gJsESxΥ:|P/|ժ:rmuQtCp\c'+%ǰ|8 ]p(iEr:Н\ t::FX&a>h9PZ[f:VLRasr -krl9kӐa"?eꈭxkTeVv_)YY+i ~e{Q>q.ku`2/h Cџ wDfe*,+6x·7O7[ɖu㈱:'~kgTT50k$[:xsµućm6ep n9/3]4_jbLd"%F"W&C?z3DUsS;B,|JIe"w.'Oό8z|{k5_E5G` CA#gƜڊ#÷TAK(:vwM4O%o>v $ļб>@DqRQk)F<тy*Sy y9ɛP6'.dKOYgkƉ.Tp =`Q͘6rGt o;yMS n_Uc1iPt@o_cɼSS=1f-\盓|zTԤU>M8T@a'bӖ UYR;Fx뤖N^^t҇ gC^%!#,WΪ7$7mR\ҮYfh7/ϫ34)YZZTſ 4n lh]?@ I#x'C:d\ߋ(q/lzPW ))2h& 5~€[N͐ 1g@1BJ"8mO2źLZ9 g`h>7f:GN:!{1|ɻ;`LkHy2B ^Vzn`S G6~ޣ:7.Q3讛I٪UIR[o 4SOqSIFd~BGa$v*:5->?s/˱|6ܽQywBC9ϟelwHuK"VHgvpl^ceBnRCrr~.1=W3tt_ʛ+8(hFv^q&A@P1Ǯm+kMзoVS y5 ǞĻ09+S,IdưQb~؂R=He'ߔ7 &: Q]}hu[ȗu' FsML/ #󊄋?!w"!nuuڋ:n`^nBwxl=93+)aljIZJwF?h`[GW(E%Nİ<*+Oxf eh!8uO2r}Y:]gdԆ[|ΐ^ 38m||őLyҵb~}^/pDF=J90!By8nz 8+U On]YS3yLg3Ǡ\g9Bl].)2VӦauÙFPX!!1~t1duZ<  oa_!ppjy6F$_خ0{yg31,G9Jړw>+Q7Ctގ'-.,)?ItJߑ _̣~D"O-^\(#K# 8ݷ8Co6/qKOOi@BV>~M3{PIEP;U|>cG/|洜Mh~/1aX?{'le'GN4t&JGryk3_ 8mt8ȜaGRE;^ڙI|~;Qy3&M*O㌇@c~.W1G*c,6KQop9^_U`HwWCA$L9ScD@0Tj> ?Zh-e]@'us00 JI]S9ך=\;elݧxPu&nBX^4 eɛSI1WlҔ;Z!a|24\WL/gN`[|Ġi;ڿؠ /p䘣 Sk+Y͝->5W^xNpPU‰Ezhehw &hKN_n~f1 CF4PTr\cjn=ϑiUSO>oug9v5qZW ncM2Nȉ7$+ cq@3؁IN=Wyj[j(W5}:8ZNM)}>q|9[HN̿w#mxl/9V+dңoƙzeŘy}`MKvXac-LKID`!}H~~")Y5pKeUZefl#itoա4(tF`xq."20Tiy=HwZףrt)Za&@oL+^/rP:]\yL@MK;n[nSKnWQQ;JԦw :ΎNۉmVo lR\LoE,Bf.V(bTT{P|?Gya栜yˠ.8rL !(ܽO&ΊE8qm%4 hFϠ2ON8'Ð!p Kv÷pDʖ)e@#JOw'`..c9~;*Vt:M3й!p/,Fjz"g ιKt\SDM:\f γvQ7E1h8pPNԑa5O]IȗK)Sy pδw^#PP NhYLlimm7++oKsSIhio$J " TOGd"/?ٜL娞݋=̃;;fkh̥yQѽ8NbK3 A  zio`22A /D ORSQV!h&jzڀ5B-}v7/E?)d=F|w)=2dr6SQKAV<(!::`uuLۅ_KŻh1Oo9$jtȶ$~_ {egaK:U}Rμg~ n QZثI|%Q  䖓4*s??8 $;rfɶfQK5{Sp2NɁ rXV$NCҔ),B?Pa6U ([1>R,k"8Ҋ{Lĺվ&MrX{](J #c"(W_j 9Q Iv.B=7νFrY@4!;eM啁L!t{EY]DEq%lɅ{k65eO"R0$',d~ Z0u f ˼|T`>5Opx0VY2de άHJkO~pKؽ?7f Pj͵YQ@ݰE+Ff=Ѭ},RCv+Ճ"O^=5vJXd8@煂%uܘ{z v5mK~D>g+_&8$5Q)`v S+[d9 ٜ-TD?l3]r >#6"uX'Q=Fa0!}dֆ>^J_c:B!@ξ)Wٳi.ʴ]Þ8YCz [ix9r'Cğ4#`OǷw{Jhbª^^ t6 ε7Hi>t?M l;j<0+U ]Aӽ3&(}y{O ls?ho`[%CEAX<X2shk0 O4NH*A<p !b{~qjܶoj; Pz|-bVo}2: *=9?#J"qo<[l>NGћ Co'zI\Ρ~=^o? @B8-5.?9أM8Z݅k:(O[ p؜ͥĨNv+9lZ D*tm:,g#l~ X-rxb=5JA9K{ixOy=S8D=ɧ{Ps/Y 0dG4*h+!B}>vbO4|(XT1a+sxbO}JX)~qS5%km>GohN,>3~ukP{8ӏ0Pnc;3aq,Z.䬥 `0B,oE)^.hx^;EGl]>|pZPtR8* *!9DOY!@QbfdFbk>3I&5G~+t`,̀a$I%.u O(ӈ.sCSq|'rxLR*,÷bcxUO":xBFHFg!et~E)j!ؽ>3C4ntorA)řRD# DIZ EnA919 0|8Eb>¯/W=6ڼ+DF'඙l=19OLet#APoŸbsѭyr%O}ot '+w.4xE3F\-G~e5/t.n]r6B_VXF y1ˆWp"]` zJ4ϩ2!#b(8?>H*>Ϳ" 9XxТtpTYr{9_+h f= љPᐞ3GЦNXLy ln9!;Z7wx/:j;mEYUFZe1WF }IQj%w-%l7*Q*p]93pxzӜ=,p# shET ,?%I,ezAHȭT54#Qc=3J0kU!l{WrX({)P,>IN/Vh:4pmM#y%Ra敲SdiFaF(9{J2uuUHSeh܀;Zl||oz\I|Cr`sKxZ奲D !oQ\5u n<KIxj,;=SJeh )3HKi B ̹~#gH߶&IkTT0ZA/)+Cx6Gm?Ѝg L֬|!GlIg=#wEuby~SAiׁ ڗ*!յ:sƓ NwNqK-gRi(gl3&;v,".ʐ ȧ+R}xz8Q0%1*چQPwsw/'W|rݙc>-cbz)Iz %ΔWbV>՝ETwg>qR c𙡋D_| TK Q4*`< |3HRY( hC^fZ{#A)|7n=lon2#4Iw6@s,0j!z(k`LR"T˦;t޺ye U !">gWc>և"6"k! { T7'uAUu0-g$l `k6@OqGhPg.FHql߂ {B̭ل֏xKzK`QE05cYG3"T+~cJ,rР|M Y*Rzve7+9qŲ0WOK6}m48l'[X~6@}4N|EC$">V~Y) NÑuc)B~pDZ0f{ď;x€ ט E=biߣWBIs@rR'h٫ < W ^z2GT~\ zx 5ZTBX r !b#eqL-,QX[du'`ETeνF+Gja=E\2(cmπK §o.X c:l uxEi`i5[7,ݫ6siݐ ̰ɝ}9 c(ʑ~:tUlX]U-~b[bY1_< _1PcX L󭺟&֝agnld p3Z7O\[2!ܬcG@ z9́ʻ,T+u=O'(# Wn9^Ma,VΠtݔs\p,LS#;;~9_k;mű*wQ1Z빝,_/?@[;d` K-"ƩllH˷-x-TDt1C绲7V A"\V/ g&z!7~Oڰz$os,,*7V ʫo(dƌ؉R޸ jx>_wt? o2h ټBR@k;e]@ā폃{7 T^IO[,8dW%'kESWP睚R4&S X_cjQ#qi&x!Ѯ8}b9Y7N=C|7RSU=[6Lh`nn*2Ee~خϽ UDTex<-b\pt夊2 ׀*p>vg5m<ʷ&8u̓F{B/ze?;_Eug9Fx/ŜY/l=aN|FZ7*!уا:Vg$%/τ'Ͱ9h)yE^! ؗ I-F 'Fs;tpψq}2G\G5'ֈV0m3ɒsĥP$v,hpmC=k/TYUM9 |J,K| 'yX%nsj&@Z}7T& ,!: <6Y{jpBT~{R|ݧpQ vBDwGo(+JI?ubIM"m Y< y ezs5J褐@vFYҧ:!# {PX7Rwţ)F2"ݴ=1?]k=1Iڕx@h=u"l3Jg֗|lwg#1sB->i,/#SDe\ MIfKNDbǴL/^ yECu;8ֿ|I;9=:q'v.î=iJIZpEiC"ws37y*HaŦʃP'g S y7.QqS0rhBAުpJt9*708צ}c78u[hQa7jo~6eOKJXJh9:r(H ( E8$̥fcn%Pj ޚF FGރiOWkbiCkJ'M&OXz;ѢP b#%=R$Hj F͏5t{j G qkMs\oPx{[uE ƾPK:HR,l."Mm/S,IXBENUTc:lՒ .kXgl~lQc3M~Cleh+_ks ֖DJzR+y*=Q2׽RN Z= МܥB;#a DNLeΎrW ol#9YTm`g&̑ WS `@a`x:xp0!y/t`7)vK*4R!vM*od`j|F"벼/x1Ψ3~"M-b ֜V4qS5?xc$ParJVΎ*pr~U -.ƯA}(FvYGAxZq,b9m ;Suy(_T< y9C[{A,tI7aNBm{7(_uz/=y?faK,RSp}L5XN\1| $] [scy=GS`\J3ȏ ^A7! 8jMwıSH ,ܕ44fб9+xYgZ-ʷw6!*^6V/X@| eHQ33f~hI%b('~16\bO?ݴ K HEJVC\?Y W+ju\px6H`sK!A`߷D^=MÐ:{aSbMrQ^V*;@yDBVߋ?V+hI(P1qfkqϲBgxN ud\OyeVO9˧fq^I3ks(_;D:y`FBp v@ vnn8cx0'2c.%a,Z7q/cܠ`NxjNC>K|{ lăHqe!#O^r7F8`LHY8>6-7ђ!/$=sOH۩iՑ/pvu1xCb[_iy@»]dk׍@Z ƅӔdrd o -)/l5q^mi]Η4|duztri/%|͕I2Q*kT#nz0Q 7M[5teMChWnΦ~`Rizo*7؉XT9]~pSY R^K 5H (~h[~l8_!¯K1 WfZ8]WMr*]4hXJVS& (1SLO0oY")Jď+Ž ]~[NE21Y& >AJ `~a9FqB 5ՀgDa׶$e((650K~[CV͖%'4i Ez&p9**8+7 Ւ#V']a;:v7qHgu CPA)BQyZ}HϺ^I [#֑!];|*w|O8NuCvW Asrs@ĽsWYfG˱ͲmAM1})c7nil/BG(+kQaH޼XmX^+gHӷfU c( O扃?#c z,8;5_)qz6N_#)\DCMJ|1b#5`~#aֶaӌߨo0M΄Ɋj5c|+Q.ڒϿ;z]F0jWV ADQj$uA_a"_gsk݇LX6yDaxɵT^_cG. Пr!#PY,7)1wD. HoO@R3JT߂3.uHwXYb5?.k# tkG,xăt 5mD^W8n:ɾn"JuKʧU#3uF{0%1ŌH(Ŭ_}+ɕ (c4GDo,Z"|VK!7x;m( P!SunCD,ƭk~+\jt@jìPyW x'u##zj Z?̜ܮE)AI ę$рYU/U2* OF2trŢbͭn%'sRtwkQm@){F̟hJO*r7kbd\# M[R7=dDgMC9<D7Q޵R!]d|;/<8Gi` Sh_dAX4'hV8=rem8ն\ihY {zy%HK|rvvV 떞cMˇwzwJa*+3?Or䁵FdH:2 *<|D],mOgy٦_f" (4g>Ψ5<nף;s&JmsheAgšY3}anG?-KkhMF 5X{&ΥX{ޱF0R N.8%Q;"XaɄ(!,jC70{$Y#Z2[;`XRW%L@:^Gh7k+qi{+IZ`[TO l/#o-|K|S"ЋcwWm Al7Ķac (tIMAYn\챵$q+T=$#/XˊrM,n֍'n^+FVBh"K83()L]I`"AP5"V$6y1V!WŕqQٳAIr͠mZXA˖9DAV-F`O_룽ia I-ɎB)poýEs_wq\]iث (7mmܠRg8k ߗ䙏(CZ;]b@¡~V(5iJyN!W B-:5խhB&ڴvwXy+[CzIǹ>-c >_a'JP9j_aԒOl !zZ=<ϱIxIrr[ ]hom7Pѕ%<+p]/NڽhWާ$]h|U7Uq:(׼H"H+ ]wj9s S im92L{ge?:tVoxcÖ> \*!edc-Z$d00Rv@y#er!TV*XjAEU4H,1Y&ɱ-36|b8-@1"V ZTϖfT?ɔ7_s/Ap^[_r!ᅒk&Fr 3Ӯr=Sk= }?G*XiXbK9-^Tq ̞ϵ!zcpzhV `ALrr9YrHL MWy3n fovu ԗbcpWIհ[CծP MS(2oJXלĥj z$ h+!2<`QrCSc]|tum7*Ԙ7?\,khoQ|w@ܙceF_#r(9Z@$`pg1ܔXxH>4^5gUW^nMD>Sd{&RчԡjZY!>ǻev]ڄh:$zЁ.O\h # BOeXvL+oIaE#+|j.dI2>3)Ac 0:%&}LܰUX ʙ9?N: oscmѩutTz$P_TۗBbyYn7>>PNu*@f BU@9R YcIifQ?w0˰CZ;n=pǂ +lQ5w*) 6oGPk-1x-:g-y]hZ$!0vT8+I 2mDdAF-&L0Df|8"Q=$0RG"Շ;1~D@ pېsl3s傼6#)%913KU h| 6}wىo-sn&i=so#M4ك? دW$x<-Kߝ0@-U`fiuWPؔ!玴`9;(w$ٙ*.`H`啞hgy rǑzA+"xb/n}<^924jt4荱i)qF) ZU&9sJ1s !'1IGRBjX4`2dzikq"&i&zwVϯcV FP„a[Vfh QPPW~Z?ƛ3Ҭw#9=9j!s^W~X0Ra@\~R|aw3*}D^\5DoX O;%P͸)4suk]S @}lt-~z Z@a}&0$^11VyVJJٳ`N>uԐC7.e@TEOnY7ZD}O{q'iJWb贱2NtkKZ*ww+N ',ƞYP.>9}S0jk2D6!E-"j|qȃҸ×M_%Q:dcAd;ګzǮC) <M cِyg쳥~Ј*v mb_kY'` .ivf!?U nkn;,L-dUFLvqDupK&׀ͨZ&Ÿ/`<:)0=3 ᤬ ·AhN'`?}gOlOU떟nxu zR[A?yO<8*rCTkGH=L\\JqpCqs\y< b.)PQR̛ջ7T(a{i@2 خʘi$֝ԉ,[sR9EB$mxqOQWEF'~,B5l[]çEn',L75rיHZ0ok+jw7QR{EAlƆ$P . O2&P@rcͨE6qF͟A^mˤ.ۊ% }4S&>P%`meGdU^IoNY&l@ٜ.h^.z뻃qMuakǨ cȳh{O$SƚYz.]xPǢuBRK=%[zsjbVMݘK a~w j 0Rv$@3D PFM;ߘꜤ+p7*s=Nݵԡl&!tGwN5i v ){3c롅 Ǻ۔؄= M?C7XހB#q}M0 S gIB+Ga[9%-R_~F%"f4S"P}ĭuW_+Bdn)Dɍ\DКI*8^X$LhҧéI]j*NA-Hh$U;I=d0 s~^|Ce/[D%wAyķ/-{ޙDҸYn>=̳d!268$`.iB׎ׄ8EP%AG(HÚMa((E֛e[2|0],JE 6TFH '% LEz-{p2lenliyDk[rm1&%y]%#P1ukF$UuS\ @4hRNk I*vL!f!,942H^ѵ].dDC#{O´IosEt vǼO 8챂AzS.D'.ѡkd6=x-U0Bi%wȶ C^lgu?:ѠS.a,:m2FMe'r0 ( ?Z*ei3x޹wԁb-:r77:ޔ ~Ki״X&e􈈧Cաf UF!s::QNm7Is*}s s|w|TL$t*ȯݷ=GK(X4Ҧ'5!r5܉U It.160KZUT=aɝbK49+jUö3Ebo*|jĵ&: ꌍJuUtpnOˆH*}? WwZa۴i$5Q|KCca D>둶*HDO0񵙅9w|o5=36;q:I~3x=fBJ}[ĢP6N[hNRkh9yNJSe. dbs>synw)'k'/ʝ,'xP*smzW*LNJ^s e.mLm0?ӏ]\4$%:[a?Rc=1Djod4ZB8DSl ` a(̀=Qi9UgC[ +21~nYAUX}'%(G@:y"l 5\ lo/ 8"`\ 1q!#'8ϲOhW6lx;q\fV!hKCi)ig RnΎ.P손5kJr{:+dy &F?>o1ȍvn|J"we}>T~ U fu@4D̠١,y'N=`x HQ , vϤ׺)xT,^ɝ](;He`#aگm &Ln}j6|ס(9IF؏ENJdL9.x,k.!%%f1b%fu`5oo]ng%bܸp/MJ++V i A۟v*۳F^dD.&\Kvsz%ZYcQ>x!QghX*Ǯ=K ԃQbѓ}XG} DhhP ,A+SǚqaIkYcԮ !o?"fiRa *+>(k~M+XgF7Q$'cΛP9Ʊ5JKCjDO[AdP[Đ~' i0׿nӧ䙆c\bI@ b9?h2pST_;p΀m9) YV^m/^N}a銼UkcȮcRŢJ<3~(y: gy zDERqJF|~IBo0 7Auİs7f"y= 7ې=Bū1lNeDr_\ #矀#BaerPCsR{ޑɓ7%qehV #j]vzBǪ_=lcJi .LA<4-aD`UپU<- 3dN8JՙO@=o 63DȄLU$j -Za\eb#&C%N=AwXdqņRߊ@}P7u$Q%ʃ:Q/i&&͖swjL<E4pB@RLq{2mȍZa-zā$xu OF??z{ ]"20vw28񰐾|]i%xvj|zK&1CO-‹QܧU䷛ ={ ߝ!xsO+%ɟOMۣ C@N'7gJ E'>:Ka 'ߘfUM!ֿ;0~r8k91G#݅6nu(1%D$% qlk8ˋA9ManOW#!Թ>]iA4`%*Ȗ]9[UF Ȋ`h?hlK)Gr]8CyAqauY1^ڛYs}[6qj6A;FpN~܊<Vo ФeHe+h/CeVGM: 0oӘ[r'䪐f~sAimPtX!BzG3B;R[\P ¤! M0ȿ~]|U a54`X&OsiG#覗@J>bdn蝛y4SJgbl~N5ҢYOޝXfԔT?TrE);Т62lWOM,׸GR_iY1T#?mn9#G'hUnLm<JˀVS耐U'(a E8TD8Iapg1<˪Ũ(&ej0.B,0Ear" J{M."iV2opu.[*T?BzI^Ȋmug6`>l4e[Ҏ߫䫳ST9*B7;n j;Td0Y+e9B1M &qŜ2/- vm0™3!"\pʨi R\<bm $0}sfF +Į46ck.T0uRBk-dmi1(od6qAF la@/gf>GYkNM/qY+:ȯiwUC:D=zՎG5U}Ma{q' l~qcWzVd'Di 7RrTH3/ۄ Uno7SSb; Zs- H]Yb%WT5%$@4Y,ƵXE0fLO{H7lV☧_?Mrs{b1?{1V*(0PJ31 q8 E3l"BmThZw ?x vJ3hlO6J@sz.HI٦PQ"gb4KcD]6Hq6\ _f'XeI0tV,~M!nK+S҆߀۱\I↢ )~SLΝIw@Xj*'XzYR6Lcvi-|\ p9oaK&{͊s>>%I?`BesZd7bJ?:Bù$ɠ\B )EAa$w&_KQ:ޠ*S<+5"8Պ9<< KnK]_h|>t퓍%Qס6ܶx X}/-b_Vc̡e4KiWp*g’6(G15>puHf'vtzHmܥIJlJ<[B黜I +$U*XAkDCۻ9+i4ܥG%q>>4Ҋ!cLT k\@JTߖ[  {2Q0:ޱiH b,r7nj ;^\-PQ0j8itp]@O.',er{O4&Vi2Q 섶xmx˧5,LK|^QS~e|;`{QqO<3oFtEe envklI}LKDeتIurTTp@]ސX&Պ6$|dK:("~X="=6< \Oseujp)>P9C"GSEL9\Ykù;Y] I{7/4'F.MNOAVtcOMciKX+`$WdG?U0^ӯ~Ӥ=K2#!1VL(I(ӳ?OjkbtJ7l7ժdJvRAw5{ )cPir´I_* z0XVBTen'R"n%(]?fG#+E"*QTgN]cjDNţH*7o3=4.כWU(cBYɊaO %"ZuJwI=[xZ0x84qxd|–I%2A!EnTt7SOB46b܏3C p Őw*1vz:{ A8tiъ6_å:P ^٣ITcT&̛l{&bԗXnZZ:RW1"|c>8(MO3.xTKf<=ͩ!Ș1MK|x`3ĝ3 EkVNZ9' Q:gټEJKhvK[.)3SFd,3 H1p!tkb=(C/*URc/fmک{+"+ۆAiȁ?"\W7ȵ[wU밂9uo5m,n˟?{a^C̶VKUe/#X;L? y\^cL= }6'3L6LeJڝlo/Gŝ5̉"HܛHnF!@K% `!~`9q'M|bp;Ё; Qߦ8i\,:Eűuy9ÄRBb dZu4T(&`i=6rk 77k3L# 2 (J3ɀcQ+ (f_,k,62Q%XgP93+o~.m(l܌'1#^*lpJuŴik3o-kfzR5;Q@5A7KB5YҦk0cO)+~r9kA5Xp 2OxDOe+=xVؘaLV߮kaOD_qwu1y-KaS<֪BT<`Fg"vVvue= N9g.݀ݏoKAM VtʲD͈:j"$l PJ5MZyfeY6][zj Tξ]uhzM)d E bknN+cE*;'V(byBIazᩓ}+~Cbw<}+{Q%=IJ, q r}>>^kq4OXs,afpDsÃWCgza[k}ZͲ @c5f{de=&VJnc!d e$P1"<t!iS@GF1x).uyaFp9Îyץfg 9$#9(Eڪzsʯ&JQ.+p6v A X %0GT#*5;CS]MΙ5\\HF0't`(k!I=C.p脙h-I5K[Xk4Y%$Ę% `)iv؊ήP/{q>N::ĺhXZ(Gb ]Ce{CM ޓ8d]x^q8!="p2ۑO˳V'jmh~vAtiZwy%DM?QdG4uMLaTUi桴 1@(;qVOH9l{.u){g,0RQѨX |m]pcGxÐ=^ #_#djaλq5j:LgWceMP'Ds마L*N.ƩO2)|q! Vw}ИyGk}7q )Yt @gUt  (SS> E{V\#j&<ÌO9a%'F P@&/ΏHMGwu׆+LUۀfe1y /M졔H +ŬH8n"YF$Cn'(zbjOD3rh%kLBz[Up%D@vO E\DeI5fk^);sdawڸr̥;`^LVlo:< ֗ue/FT} Έ\(lތ@Cm$&σ/8(Ҳ$y29u XƀԦE-h?ʿ6G(~˕V4@U 6B1ˌg-rKiM!:8Lyx8iȚ Ji ;2mb|y(T~V?LI'5]\>(oZ5T~ҾZDwč' J@h ޺.l~Y ~ TWP>ڋr{7׋MASHtF[ DI\g+47ʛT ?ucVC6gSORElMFSMU?@X5ه"l[ʵ<:gMKb $ΰ"ueOK")ڧŬ;6S U]B9#ø+(4m5 -C_8I?"XY8=f!W12]GGj E/@s,Xawf^dٱP(fk2DIhtW4PZF+vd|R`Xf̷QnFK$. =۩budCXz-`F<7:f+? -i(-'d_N|a q[.vԨg{6Ԭ۶o)x #y4 1Ͻmuľ-o SD̽]?mm.̯>|tzPL>ʶxx2Q0 v)]=|Nd3mx!0w[G3G245Igڠ2ZKbJ߼6E.%_Xɻ*2B8ԀˇaT׹Bjt,iFLPs66VI\k͂s]p7S{ɹY{yplFL*!"ԉ"Y%%kr7f1znkoo!C8vK_E 6X^s78N2:.Q2y+CXN?K|mdL2c*Dq8\ I9WPgR-NS%_%}$ e\hɝ>PI=&;o4@)OZڭ{9ԩ3of1_J l<) vCn#D&[[țGDV0b[b,2OXkE;F%ap)trY^TK%qxU`9iHv3&w?e:B0ׄ"B%IGk(2CAO1N Jj_߮&&'nG#38ڰ~qի>L?J+fi\ bҔeTMg'N2TQ@ 8BmE-QQU0sn[]CC9?Ρi!va8n1Lf GIJTqL/Xey(qAI(aya'˗9yߕdrK5H$p0s Dm?2 Ԓx^Or:|7d>"Φzv(&=A2w"s=֑N'Y9FNIy0Dz0j*ESѐu=ԠgI͠狈Hfl57S&pZ5BgON耒!} wv%ٙ'ۊ1OFJlK>閍bnys]HXa`X*{='puQo"wXk/)7VX-.KzqMdyE:PYa`n֪8AW&tDZՍ:\Fd=5"srlECeeh홁 .CG@<8 'yDY.=Ow-~x6 Ataew!na>~ RsfC(6vb0j\_om)^8h8yžJ9Jɚu2@L;W HwA< Bu`C]_띢jhopYIe)U 0+dgZ$UQVi%  -gϭs&`ڲM[m[K? $3 7v)j|-= ((rя%bP/]֣Cei?"ul@zS.Oe6н8bowG/O4#MeQdb콖A- ne֌kXuKe}se{bFu']_lk#T ]g]U i  F/,vwYF'rlK!7aȎp$Q3Lɚ6!2RKXgjDDPYq;.ԩِ:tkx=+FZdtW޳BN[ͅJMuiM-K7W5J1 }& ! }ĵ?g^i_벙M_ R9U0\Uaғ4o>]1wu4 >cYc٥JL,l,U'P!7>Ngln~:g .% F~ek OI2)QeHd"(}A~!bňU\z7 Ԍ&"=mv1XCձh/+3 u Cl9#c!s̜ۜ%9 =` 6y^g$G3bxP!(npu:<̔ltD4'mFiз:x+H7S*5?ɯ sҔňPp7p +/}ĉw5kEvg#k6$?NHn[0˷oLke5M ҿg(UF.&J oV–ycSQ[0)C lmW؉&vip\`.K> få%cTŷtEӺ.{O Ҡ x~1nXV>r7\jPo-T"6ږ"к4`A8jO0}xJq1$G)SM^B>ѫ+QU˴>?/0mHַ̘6_vl,cS! =>iwɾq\^ئ蒍Oy!eu;& ~`},7B9k竟Q>l,6:cVK|@_aM?t۪P'cln9zz,ӝRήR0Rc[~JGy IS b: ۬^h# tX`c.i|H;_{^V]$$32S|3XbsrBoW˸h uE[Ǹ00ex?6]׳ hin ؠnbPI]6r`7x FB`CL"kρzeIGq)>$tI8xijl5A R:ޏ) >q6Ǽ.꽐qXZ`PN%6E(%uЊ"~ŘbBT661'6 g9>iBlݥ˲kyV_4q_eњlo3 Uyة)S>T Ni(in{GaAThNJ2~ CDT3{>bO7 R-p\EѯpG'8q!C(L%P\y&D7"W/eWB[:Hݧ?$̈́c*]7KQ枮M`q9$!Lǐ&6-a Wb ؉|j>Qp6e>5^FyTUژWx/N &SbJ/D,s1lj~sdJLlG%C(v#0\FK TB>);f|z cfa)&=X))%moWhUY ;ԺJdQ sQεd(7W~uQj6sfPӴfn`_֔v_EEw)%>& J'پ: U2'Q{10ȇomi`3O  ЙiW]xպ;AV)yhW0_0I3^✲\ $)wfSGr䬶!I ~N҇@Oy!y 0H5,a!m@i"V7 ijY;1aRϲI0КogF2m<.|{? {f+UY9! wH3 ΐ/ +Iv1&V.(}57'?`1)$||yEo}ʢj%%DUA^ Ѩ(; mDu3v"]n=o ٯ1iOnȅIӝo)v1>p8SF?m9p:$um|"k]1'q֕t P 0`=u5׽q!GIe#2Usd8|ˣsyYS2mttwIٿ6#6EP n>wCna$z*jjg~v㚻T %4c{!^JDyB6oQG'RU)J<)3W/܌';DŽE{z;kdV:Lߨ_E+ClmuLY![ \{O3& e+ؼ$u2VDBiS=EFaj6g*;P 'vq*>/*ȭS^ו e*P:WPqV8bT³*̃XE${!|26~9D[lms'o;"Fl*1 4X߃I›+SўT_;΀:d#Pm?,2Ny[7R[:bpoO!Jxʈc ٷN &,h<#XxƕQ6(I u;OJ}&7jCѸղL&2) &:f wzF [; h" b.~)h< O.cuI7EM!Aϛ*2]VzaW_0Ж;L᣻GSm!\.ǔXxDOf8x]o>L&NwIm-oaOg_ HIz옄7 ?X]„kXZl&pp SnodR4LKl{Rw?фLBR UՆ:1D4|aa~uȇ%IBRqTOzY!`5?_j1QVd@2P~Ӊ/Ln a8c[Yp#kqG-tRS:Q>!%ނ&lKIe 0o}ٔeQ~חqrZ #lO!rIY$Fݶ/Bc-UG")B{̰ǂ ;WRY`GW;b'n~ .n|V@&F}+ ~v'Vڡ0'7*!ݮ`/i^8sA8a"3bud0e sLB +.j@gpȘ ^m+?^T S2[ـ`/rZ?5~0M!PM!rFTru6a[v;6|˼0ڗ!bUȭBNW5c=:W2'a•zI%5:8c̽4xSw^@z(DV*_O*KC1LcdnEk{멯eU.5ߴJ%޹O>UiRf4%w`wO?fۀV8bi u"r(:RC>&}O5kY kvXJ?ݳ<Hҷ'E>v |XX}{iq& R; 2ͻ3B_>V Bgo_FbF:'U =KcEn~$wF';f݃y-RbkYz뮈@ tZtȘu*iɭˎw B 4Q3 N(S_B\u-d}ZC4V+=&0G$CwV=Nh  7dQUt"5ZnnWlja+#͠}kxXW秹U׿74`L YIbi+Yd?Fi/sG&'6sDe^ ϟ5%2x^ozZW|]Ê6٠qݏLJNBb+,@*t4_In݄K=bֵھ{ "[[@d\\'~"Vʻ.<\>VG0gnNT[EU'aZK9&dH\0k5\˅o[s:;oPQxNow k4Ԩ*aug;X9wv[0=i?p!L}俚tl$C&F~%;RO+*1*JIs e*{GItl K<` q4HڪrCE3P̘yNE] Г"^7B޶$QZV=ޮvh7l"˙&D.Gf}fuvgzlfy{{bשU]Tjy;԰wsĺ4X~<+nj'.Oo/-5=R^] PrQ)7?jn%93Q(1ӊ5![y\E.T**e֠:EqpkW>dh !R:Z`c:z#z`Eڕn{t7rI1l!xdfoD/{4V|>g_GS`SnU( VtL$â h}RbE.2 ՖGDRw m^KP(EWxT&,mcP0ֶg흳 aɍf6?G]S<4\"rJϩ4vx=Rbg^;|V 1:Kk*3ݭ$5 QN@qy`uvFh}XSzk?|;)#(3埩1ɚ[ƥKE>)KO`#,ET \N28ƟI!l nC'_޶X'M2E5 Mb)<>Y*ڷy%~(|߫V2zR>'+5l<0ط)H#!9ذ/}`?t`ޗF'ْ;^! 2 ""9H@KbwM?`KU{=bͭo_ aYh5h$@դ^7&d*堭Jl"t^Pc==a\ ]:]`5^2vɱaēj`ZG  7hyl0;CC,#Ut=w!Հ$(pa('n'C­rv G@$fY0VD4ZH fmàC )xQ]!0| l@l ;g6H*B#XΡnrA34}LQ=U? VMdS"2ǀ:_j'hy1EA?1؟VeCݩfBn$뀰I-R)}~H"/QU+ dE0 TĊ[pu|>V]K6A[ MgZ*EWDLlًsBY @ 9H_J#gCCJ16g .ص#̤_^} j@|euaLt+B4nU{d%VHZ ];0ڜ鱥m8Ges*=zfƆW-؊ny@|S-EN3K&.ކBK,]! X2~8 ~`P>Ծֽ"H LÆ2_(bE835GN)c<Fk 9d"ӞV_:\lyh#^34X㒅ܨc>nM1v}p^ʜ\ƥ|kNg!~mCu2&%l~܏F,Ac";8c_klKSY4v3%ab<5Xak Q fЈx;}i6a63}6xgRK>$5TTԼ7NT 4_/ [:@8)=^ٌmbMP\kU!E;+ZppMժ# }R/fb-c*C#њwsS:Ř]EݩdLM Eװ/AG>:Do{BX!~S+)(`tĩ/]wh@\w_.D~lFt=N%.yr0FFtMTlLM:qXmbKUN8L@Rfdx^jV-Be@Y~sO J[?:x#C/Uރ^q{UŜ(SpQDP7FD7QOwEm6^]/(Cju@^\d]i`(_- J-99iڊx*Zj~;[kOʣl xRye^#LRpklWߊ:}E3o%ʯ<_8M(D5[r Z~`F؊,prΗugnBڰYNDm-q>&glDBj n~6#Z!2kTPTSgbUb{6rt"VqV=X:AYr'ς yo"<1 oNQ^8#rVlY!n4OOf&CUBGӾV,[># Tzl;e2cFP*"T%Ibx&ƿo==lLoWQqbLOY^5+r >'{3NV+Ņ%"ʝ|]T®W0 ʃݲ6>ԙ)Rd;78{N؆=SѮIuS72:x"!]6QTϸ8 +Xٷz-҃AQjn^?%SC\(O1rlj~$˹T/MEZyI䙛CtH;?r^M` a~ׁctQ%~imgn79V{YQp!\%k,CDYOp8'`ے,ܠodV֠H L_(}9e}XscEO)d]F !)ws,W[W՞źHSbЂaqt!CjN[GK$ ui3*$n-D0r"ge;+B=1抶([FyPv{爯}Aa[W@̩X{Pq&,nj-*]USbyh(>*x`f)|`g .,օz|C%lWx n} ?1Li hے:&0Ϟ;\J$_$fld5B[ ܺuʩP[L? 2nKmFDbQ^`-š,m4ܩT{iJ4M}ג^2lJR߆֭8&vK;Xk1+cG֥֜&ZZK0Q\,YeިnJb0)zZwȈcj.Lt0:=;DLZSFQ<ÞUL9kW]B *6y`"J_}N 7yss[_ #ŢJ 7Zй\.Y;B5xǭaݽ\U ܃DiXaJ m^W|= >6R[7ua_&XُN^*+nWQ17:Meͨ_G(/\-8/1S^b*ßfCw}-@#5Zbudb;#29QxOwdU袳ޠ]ŧ9V/# 0$͇ߺvgOOܶҫx%O0"+tǟ5ݳXRꌶn|2=.!Ɲzv'jaßlѫ{5^ߋr gqe42d¾Tyu p݁j.ꬥ?3uDqӜT>6"e %m ,M6^HL tQ:P0`=UBLA#(.![= R)5WJ@\G(7IbŝWN䅿RX%Yݶz&/Vn*A+j򐧵 (z!p-U9ٺ2T9es"92p;Gќ5ES>&fCu?UR|*},ĜFChg|Tqc֦B.6З;V `v<#؇r^LYL}ϴX6,'s_0$tTY1l2H|2 jw3 E"'ddM 3w*[f|SOSJs:{ǧAX&xq? ac0R}XxC` \2GMQeыS , >G" tI7\Z@q½ާ"*R }mm2WLjrKC{6<*Iw>`?WѬPnx-Gʫ`#tvOߍWUE4b^H!/,YvRX)Ѻ"GE,nHrblڧPt970k9g -̐+b4.%`j"o2uAvs{omCy0GN9Nu2oixKzH.ǃ Av.:Gr^:H $ Fva/6]L,(i/B*+=ʾ/Yoװ{$UD (,I{T\zMg|_ӏ'P;r)۩GD0՝M0;Ⱦ,. D8Q@[ktܮc_ъeZ{{Kfh @TЗC/=dA>4 EO0df5JwuT z<ϝpH P1u٤((54(K<52X&~`G/:mnLʆWF1 .H˿ (ZaQH$4  bh͍Z3A[H>ҤyfݻuK}{\ ئH'οOhI9pz_~&;T1:K@#ZЏi*_ChWBhԺ|١X?b#5ПL̠ +XHD U$㗌U@-u مew& $( C-ywjlRqP\1QZ}5.(r К%40-#PymfȖ7JnҋQ%^,Vhc^uXLU#F 1k#4Tb;scbQ2 h"HԚױ{M1c۷U\܈)28j`ֈ&L Z/3SnEo<6&JE$6?cxw#ЩTޠ(b(ocu4.lD0.`:\`( Mm&ѫ<,nQ[\wcZ6Ao7&%˯qxx̹-Y_AD;NYd D+H?Mg{áx)b&)_;GR+M YbiP"U"ґ)CH/Z1GQ\Urnw Z:-? !9ۧ4}o@Z) S2f `B$cT]^K.=6fHȂYtQ(Z82`yXѣhH(lɵb)hfU3dkړbE8ILu`,SJԚ^{K&62Ym)&IchZNnZfV&ZHsb)CJTj(&Ո6DmAFlj*5s[p-AkA%\%tmo]*TEbkTY$ԅEhɊKkrk&ZZХRmFlj ѭ$IUzB5ImQԚHf6Fhڊ5Ƽ1V/Z1JUحmyA @)׶#)W6v=^%Y6Wr]ޗUs,CRżJ1 If "ŬckFĢJE2AHېh &PxÂB9iWH$E1;= 3MEZ^_豫F!H h<\M4BEB0X+]l·>[w]~MnyW*ks̯D]YD!eȶ 9eP5fNZO5|Wg>C0 &DAFESܷ즮_sg‰VtޏƖ7,Q33|M g|ͪ>"hkK$jB[ԍdȒ33O[yt0Q "Ff2$J{>Bb)v[b?[w|8bfaw?J1.xRt"o;wD 2P )@o7oEju݇,zlc PT&RK `ƀe->My1tZ?{;jA8g;aHKB ?u΋Qoŕ!n˝:_ LJ}w>GyTwޢlolCwN9c\IPg`YHRt fwut %p=3 W} Iϱ7_adX?hTQxiYOFL9N00YJyBxW̩٘m vvQ[ t}K!GgBhѓ3b^QYШ@ X<"ƴOڽvO$v'3.^Uoʊhqiذ1j)dWwj?]zE;j:6y G8h])7u^ '~zj&_|GպPcqm)Son y{8I[^՚lR3Q@~_/?i< c ɺM9\'Ly^C$'#a( LJd`@3Bt$89z,ǺZ]k==N,~~|Śj뭤[r]8hSof'E;RM3_[|4՝w_m  lxL;6{D$jPq|9rRZ7_pԺ5!vG7~i= H|[qWW_)7}chml ӚNpCVDBЪ!@FD ȁ)I_%Eu * GԣWʯm-ްo wBHNɐatLWJ4=wu#nA L@ 9&j{mt34dDّ_Qz?]"iov>4cFjÛEǢ i36M=nGBXHf{\cw-0 {$t@0*퉪!'xr%Ѫ^qsc٫[% E!ibT!F`M>g?# 15,7z>+yc%o།yMIg4 N2mj&8G=SRXwV˶wk(z8Y0gkDk8'mx22 jڬl%@bnStks%G=87H}  8btOW*I?e'J 36"{EPo6;1/bAʼnPl*UY?Ȁp3|s3@nk n˘Zzb&Fnfo&ny;ZUJB.m{\p ։ҕHQ!LS _e0^sAok^F\Qs:- &eUL4UBNrIec~K7H7s_ǞErڌpH<) 1? )k+Y 37bK|-Q}E˿`>GMÃ1 ," 3d g3 ,wVi|KAfHّ Akz:h<0Y$eHf zy0WU_9 |fKz8|_56503?éJ&ӇI_U_f OeK+u|Ȑ;!EJ!!I OC]>-^Lm &Ysp "pUnohY8xaNkA@V1'0[Im |"o#[(yqMG K!.6f@=&,^Ʀ 'lU=8l9Bo"{+/KHWzH_׺ $! MriflpL QGw]+sGӤ(<7`H; K~7ajCo_eb۲F/_ ]7?PoSi5oh,ᰠd>E<ҳqQ2N.,T J[9ދ)g\{UP4MRNԗ?tIu]݋?[;U|L9(o?vBI![J!}~=Z|q Ƞ/(xrp'szF< W%Wōt?ϰs=a ?u0y!Hyd$Ɛ\L*VTo}{WpqM&DB2l zd;8m uun PDؤ5%^E 5B&ՑF@s[ $Bd*%.&2vz6RLҔpBrK(ky6hm2Ck%Sd5cmlҋk;T(혴TX iBQ") AZSqIw*M3caoL^ ;D X(CR4&)fa081kzfMib fH 16s1ǧ3xqFO`6U[LusrehA#TwpҕXՊ6ɽΪ͆ fr,6cufH{$g[5~HJR|۸ező% ԅ J a[R׍n[j<]COߔ%R2Ic .N "haG:rO%'1mMAyvl0ʅkJն&KZA' l0A^A|HP) BB@#$JEpzɃeZ l([dEeKWNj M_! 4@+4 G8P , H@*J@0҈@**kK)VMQkkRP*R PЀR4<%P(# P?YQ6]z071Tzb?RuNBjyj hNb6ꅣIR(b 0vPv$][ W7$;c8[J \-B-hPm)Puҡ^ i0UMBE,hD{ t/KȁqD~`R,^D5S\}[t }w;~I s=m4)v;CcUP}hX#,u=Y9GzoQîvˬGt;wi|7Ze[|W&kiy$4$~g`%F̴` \yK׳bd$,;A QCV Y==]R fTKeZvwUAP3}^TNYzMIש,UMqP][t;@bx*z6Nا\C)>oJu-c@ V 78 !DuͳûcOz[BIz'bRn:ޜ1UJ mLQplqʎ^ f?\\V(.O9o=j 8rǫ"!mfzllUoWMC]}Uߏeϝ۳LvUMk5iv2^8m[?~xHvQY~V{|7M_up/Eӓaf%5xk Ǔ1 OHH$f;)^i647te|e )le^.Xk-&%u %9ap4)mZ_mˋhp|}}QCS?yY:8%*/!9a[Bȳ#~ubxٻt % qN!uoΗwqdㅫ->/YAx>gs3N+ݾ^x?'z~a~W%1˳ucwU{7"r{:<l5(o>c~5cm/@%n[I.&)1顆WR9üN6W.LϷ"$VBzOl>xk_'=TyJv }8מ֯9Wj~t08+mޕ\i7T%*_1Y6ݗ?їդ]*{t!Qk֐ @Ӳ{zeY@֣qo+ӕ}Nunsc-@ro72ɰ(pllGrvʿM5M1&mD pi#' x64l6fPH PR{5.z?g3yAO}Yި.{z- >?}}sk5hokwI|^罨UJ?iCo/ 7?yn~Lg0PRV_rub "Ob(h3{jMQVb^RğaԸ [Q%[0PT^l}>λ+HJw5!=[r>1/%(j}gc6]?ԛd0̊`Nc'4Z42G7{ݧbVYjbƂZGyk֬rЀ XO~]q&w u\~26vR.0q~g1l Ca\,-+eS/bx4N?yѐ._sgY<4jӬ׀`DBf>7 XlQƈl W+OrMW]1vPSغ'UMwSm7mo&W.nݣx\g]vDAK:eN9DPz "J:#4gE@)ʣɑ} ٽ)}dIx,̢#$^z}#%N# ?.&$5 l{eMc*sQy*p,-O2FT3 T 2wyN3"\YrНuk鸺0f``jvW?qkpBP.  _I*+~D 2CaGa[H" Z0 .:oRs,ze f`>Y %U5;Shu,0dq'%%K&Bb< F(D+o`D l 9!klph~g'mh#QO`h"gm1x`0br[K2t33 @-Lz}m =Tvl:$32}ɀWRci Rm4UKjH fq6g}%A˜MDzY|~]|(0fx$-*`j~(I]Ub72v@D*6zhIV*%L- F7ߴC2̚IeYPDFΝ%T5w R @okڥ=$*ߓns͚@5ԬXbn  xx]'^"+a-'?@YoVv21k1ԷƇã<Zi/~>EtfH{gm YvAc 5NRTDu];+ o+a+}u8<=x VI];b-S¶@_; #3:Cj&طlӈ(DP0[njKB' |O钯$vuuة [ry*)S9 *|ͷu_A.AoAɽ#,>~I@6\1HQ 4h3,s)̤˜8IP9O Y[?~0=ukq"Ϣ(HҦ4: (fKS w89\f C ˻.J1C..j,,{s{g l,N \Vկ\ZzUQmL|^|3`lKUؾ *rA'mķ$Iz(@j~txZ$LjzK2G<~<I% (4N' o0[sq z˶2 '`A6'N))< Ɂ|O@ϧ 'g4rͬ|tv e$ +L>V9v>]A%B Un(wMAخu nՄTH4.C晥h.7?:aF\yڵ2AeP=ކ0tf/Z*>X0[#a@VƺI HONz9}3˯dz҃# &Y-KwՁ,n7͡;^.Uz]nsBgOsfna8dUq λ]mOu_vLO:X[ -:+[*'K.-?zqD hCh%X% J|V8ڣ}FϺUۈ9#[)ZZpbSBtX qxD!0Y:s>=`ۋ٭_FO~֚nH%%U7%- %^N[ >V52k?~l* U26tX2!MfA8Y]:KbK,'^G""QT4r7x:o`c=L3]~t.Ow'(F߯RHN3=.Q!v_k=mQ4<~ y]ԺL|sV[V.k6,}VfK F;;须Ǵh^wدGt5K%6mܧOkw[ ^WwK籫q-Xkpj{-i{m}^K#zgէ{9u@R|: t Ǹ}coB=tFePx/>  `=Rpܸbm9[1_u_F*i\|bQD6ce`T|;E[w: V6׮{_~;Un=v+m^꠷q>%]pe)tخ<_ܶQK5*Ď*ӍRvz?% #JjE5GIl=?]}Bn*}ImeQe`CE^?Ϳ/DBq̦R33,?B5Fɿy31mZ69*###7;,ÏөŐBm <.$۹x`m C 28YxURc/k0MߚOOLN-Fmx% BmgD܂FdW5 qMtnfTzbz쌫,)ظatc Ϡ;9 zHuVF0</$9&BvIHmv0غ8z |='}kS?tO6!#rr; ? 208Hw N@ھ@w)s)Cez޹Z}ni{|{>W s3}}|C]|}}<|p]>'ܻm]>Oi{aw)Εr2[˽}˸mOV}[޾{;E;+wl/e;:r6s#@֬5iq |_MS%$PPUWSFXABUJvjۅ)T Q` t0 U[{B-z䚐ܺ/@i{\_Lf|N^<}yIi_eӍ@#mkΉ7-vǺv 5>y-D{z=yNN8 }} ;͹)sk=/p㾅=7=V]xi4^^zå3b-}hg燞}̾ |@ucN˺WN]JH4wa[}]]oHG} uz}7W`4Or4DM4 Fi0S&FF&L2GFQi&@`!ia4dL24LM0O&djfS MGS4IzjzSA!F)i)&Li?MO@GɅ#2h2'@ɴMOQ4ڞm#(zD6j=M=GQ)6IꔒLL== 5 M 4 LM4@RDb 22iS"~QSy'j0jmj66IM 0ɩAHLL@2iɄ4ѐODژL4`h#24"i|𲙯iSW_䜄 ^7c-ӉPI>t`U)Ig>/_I_œv6dckb֩l扣oܵ*r-a`k<5]٥4.PJfTxR+bKSL 8 Z+ɒt:W$M+܁68u 3Jqw S ,0 ET0Yɖi E;k'DI$34^.Z h "cyBqۣ`T9-"({I%3=JɴFc62M}< *<>zSC{M6f ͙76s7 ,eKR]n `Y[7 32fmy!C'D[KQSah澏3YUjBe~Z6 ᚚrvg3E@37S3둨dص}0VY@GE3ƺ0*5 pk*FP8Q ! 5حTM&Y2!Х"T\mLQx $ ] fxە:7I4?E JHk;Ekb1uY.XBg5il$IZ5iN7 퐇(ebW= &`X=7:D;EK)bW@Dt.FS{y\GQIϩpu:0sR%3|b3e7cIp+3Mq\Ł :"j0͚JVH - 5"A[ik(!$}, $8ޱ0)7 o2ԣ=li#IʔmO Qۡ$Lfå,h76n9"*H $̨BfV!&h ERYѱI34CѴbFѱHjfD +EkLkFHƚ6A-bQV"Tl$kBT0bFmF4S1eٚ4F*A( )M0&R&L3J6ͶIlZ6hlFLQe3"(+4& K$J3d`ڬVZhFlB0,ŶPkZKF|]W6!bar\ Y%i@m)@F6@6Ii`5QIM#EXѣZmڋ5mXhH1%3Ji6r6TZV!3TV#'tHf4mjdMZ*e&j-Rk,c4f1e%JaR֩VPh7Ç?L˝awqC C]59:ЁHq?2:{4DMnx~mQN p.c_? fW]o 0v EK{^(&✜}=su8*bEf9#XeiD$dLi]ޭLDJi"v YAّeB@Ң-Q(XDAX*T8݋)7Ljs/0_cA_E*Q'p01,LZ3maP&/ky@RSd9ޏz9~0sȮҫi*1f3&3Nz԰i'N;L)\-5p^< VuT:W+winwy޹^[$E&6݇w7] Z:ֵkB,uW꼙H1){<\wן=G6 \ w{Ddojvܯko i)y+4 )KZi@yJwq)צ%\k男R wu4v2b+g,mnַwQi,$U$5h 5zjkuw"=rQn6W5//9ySU0QdFk[:L2,Z-\-}Ƥu"\Dm3cDr`I-4Υwxyg;:DDC08xgM dYahdhf!4QfA7.\3[V.y%'tK0$R@Pmꖘ䁛+NrZ3+SѦe718!pꀵ,͸h3E{JkK시DY`1䞹_y8HCXp b({^M#2!+$n9a!8 p9 !r'k| NU-SټLGTv[ZS>aM`6?,Da,pUɃ f\Kb'LU@X3.E 3:</36V]mo[sIr BOc .T 4F3L 2Vo`HA g+dmCUh: \ _>|'ǥ<{F*a-n]o~bUATI8K:xlNy{0wtQUDgwXm!yTQO쎆(ocǴC9yY}k=$]a vĴyU`2wc %ĺ`x&d73/fD|o7(B 3٨^-Sk5m=F͎~qEqBmHJ:QjHdɹ׸^Q`#XMzgn6q42 P{MZ䪞M'e4kaVr30g_̙F췽{%rIqA VᏞБy@n:6:+ 9@G f2 ݖ% ～>}~;GYQӦzEԛ թU s|"33x~;ݥ) R Xj>{_ntsٞyp ܜI*JPc*&+H:oDu\F-m/WY+MStXR[|/0}/ķwXoe1sv I;QNG ^zʦlGByvx7mzo<#kh(d ($uyGlp66a%+}u@w y4, nYŋ^`>0V{z.3tX/A`3Ff5.߸Y-^vnHBq?%HO97l+p!aժ2,17'Eٶ0Sn,]LrHh;dJ2IUٲ 0zҩO2H憠/y@PvBreA87xzG70.h@l1ԏAZ(6cMa%P BcdBMPk]h,JM` @LAJˠ6P )@Ҳ}- 0:DNe<8-s}*!좢_o ѧ53Ƙ'S󧢶8,Ҍ[\[ WO3_3j{6t{&^~Ĵ߫sA2 aaQfDwuct:go]뿓Cy?QC^{EQ5HU'EFH,Sh}# SQ{~!_}=ixuj>fO]Ei1~j@":OB- 8Fkn͊*e>`F kƲMlD(D ^7X.zr,cFɰuSd ")`4"]I"I F!`a{ wx:ofy=-S8Uu:_4>c편ڒH2HĚ hj.>Cmر) #Tj-[5V U./FWd IɅHԐiA5)RlJJhzlbK/axb`ykT)4pXiP@9yoM!5|lV*] P-娙)ZNם?яU HHvgv#ߕs KD8 kҷ'>Tusz>X a! DЅAZfY˝3BIBI ߯|,|nM~?ׅ`Qi*-XX+ƹmJRRU&VƙTFb#aF %`J؋IREMT`L %Ril60f52LEcjmM(6-(LFhQQR3bIBY&i"f5$Pb2bXXfmLljH%i4kF 5JR 24dIVb֑QVRddc4`*R ܈dk"MQEnJdVFٹQW*PH%R(3)LJTQI-ljitEfEc`-&6bFh*-AhSTEh2$һ KRcVUQkRR6J茡0XNr)Ebch)3QSLZe5LkfW+kX R  DYK%*ҔS(cEc"Ne i-dS[%mQD"!4PlȠD)ZmAE؊FPRԂHMDEQQX"df2I!5hbS&& XҊ2F!l$e%TFM lV+,Yd6)*Z[#`C%Q#6XAfTIQZk6F1f„I)Xc$WZ+,cRV&1adRcDkڹQF$HC2 @2<;3Nj14! xM"BW;2qfmw?K^}{I!$f |+(PG3P"^hҌHB`R陓MȚbOʫouah}nJm!ED`ق [⑙_ODB.'5Vi CMٽH@z*DWJh㟶t>ĿkźPyh - @Gbr1_ 䰅BW'Lwq6 v_΍wu#25dg^!؆/m?-md6؄;:vI"Yzgs/[Jb3"T GMf3:W.dUIj)f`(HFR K+.gjWֆ/:PY arЌ*\#3*{?H+c e%q8 A Z4"&rlƱ 0w f/5h` f  4ĔI-1?F'<^=h$wj>`aZ4qwG=@t@SrlOzB̩5{ M{0`9hJ9t5kAfmC֯vژ0_T@J_L6=dV ; ^0DQ@ftqVpPR` 4,N/q» cdQy!C8uOYԐLJ##DPi' 1As2W WYu֖6#0$͍kO^E2,4u堁x^XIOsTokK=,@*hY/ў.9z}Mͱ5V E)L6n>Q'2ݭqm`̚'tnmо7o 'wK;^LJb$rF1}7eY ,rtSoWۜ(`om>?Sb|AI3]9כXFQQ謇oζo:փU 1j iޘM6tӜ z._;V\S8ෳATʜ:ӈjJbq `{Z4d͕tn=x}}:3 < FG%<=dqE%%T5˯!$qK{9I6^ T!>xl|G`e [+B8:ް63#Π!K[e@iJ6{45ke 0fA'<kCfI:!@ج° -zz-ӽ~%ۄYÇ$n`nrC\m*ﲈEPZ{^0HaOwׁc/QvƼpvouMqB@'o[ VC'\3/[K Fs.9]۞۲l:l]A;?[0 0`C *?N} v;/9\@#5Ed6] "K0yywPpSCNJ8jxLm1wro潭2w9k, 6LSԓYxkNS0P9R*GnU dcd0]WSX_4FȲ~Cu"yjlH6)HCFiB&Kf}a=QѾ(:Rj7?|;7/?9rm3zYu w7mFbn@1K_saPPVnѼiu?za0ڀ,qE(TF T.I;Q0\qqgZ%3ole؊fPn/zE k=JHf59U>v˄9Q.%-9u {;7CDϵ7MT1u:U{^g#Riyz1i&i:x8+k{},Rޚ晳kI˳d3eit뷸Ărf@" $5d/Qz}k #\-}{ZȼZĎwY2S5ngy3 f [o?Fe2N Gi0̌ay2=/h5-vn #I-{ęGچ9JJLGT='HR 9 ۦM 33b $g0ZҜ.,VL*&)h͎smi637pP~d$ CW iۧw[wuP7ywb U$yFOمqRو8~[ L03 3"39G&ans{qSn c>PgWa/OizsJ5E#TܽiY| A^=>kgpxdRUUFDE'{FH[K,2-MkEN滻C( 5<ֱܝx˺`F`;^$o>:ob3*)SARȯa NLshkhAƶwgJѾpinoTmxcqI(jZ 3ըUMiu -.qa 2JɣG^nLljU@TY=g^3KT`5 ß\r829D o*K2|<##!Թ*vaӵPis8 $w ƦF(CkRe bo0 ̲Ɏ 0g,y6.|9Oð>"( J 0f`ӕڻXA*c3Go 0G6egr*{<<)bN_Z!odnnfS?Y:粀3uimekEOKeF&%;ݵwhK0 f5zc=k-fX,N.;ff9H҅Gw7;W3< tO)ùIqֿґ]Vm?(A=L,zlymQAY;c@( ƎJ4`1YKyi{e~"^w>ݴ,;& .bS!UH5 ng/{,ىuY TkB1Cj.eFrPL0f E3~Um&LK2@hP2奴DDQ>-! =t M߽m ƀxS`t(o@ |A ᜜Pj4Sg;hjjjb;L[vڊxHp }⩸<ʭS6N,| ):J(*GQ344'x4-AIZjzxw@iy;~AP妈G R9f|̨M[4ߙxjPj&~Ξg⋱핫&ECx Z0 ;[f8,gefG`yѺgmۊ LcfuZC8j3ӛ? @aLCfIhN) m-R6)IA$5G_=G>1$wm7wso_[ugV䐾yS֌CQKLQL#_\dYE i#xI0ٴ{8'#$0W _^l ?c. ;k@D/s,n_kNo7(iTp'3)`Y3w7u GyQm`[Pzη.Nl A9pgrfd- }t;T5јU3%TҪv}wymo3B= ќn7pr@tYzA$E8km,p'}|8ԛ缃mbͻZ1!T2SiD78 Qn30``G4Uh@{oQoD=~rw]2I z8u톖>Ucml|yMwK;Mtkv%;:0gIYU@lɱ@`FBX\~z{WLcîXt @g7R%h2x !˾ocj$J& 2_{]ᒲ};@mOkopCi}\ݨ$7[+7Ub['^J BPE-rU+[ؽwV>׫f!ӡB^OfFN AtɆZ>|x\Kݭ\ Fզ:밁YEbă#Wsx fO1ص+АL=@{AXa! ̀3#m0gM-#oNWO'A_Ш3AГ Aȑl!  +2.bW}[qpǿ>ٚ$EkIKE+DLC!fO FH ˠ:3RЃ,j6FF)ñ}ol#Dgi!F%]GRN-'Iĥyd,A |Ů0JʪB djLXdfLiy7A m pI@ 3y߹h]eFB0@2hGD h)0}D<;v#21+Wun0I*tr*E`={eUW#ZSU+LfWʷqLʔ1J}clbGmP| #SyjWO: *;1 H!K]%NxPQczLBP [B-sRe`` hd2Եkq2#`bCyhxҲC" h܈@uɸa $(T' $7G#^yZsAF""q/2AWz6N'THaCJP}k $B"w.8!r*7k4y sHzvb3ʎ}qVuZ2P#3PzJ0=HR_{12FK)QD7:{Z;%:cPkNpV P:ή,a:cҰ*vtjS6-w| 81Y<6Z]}z ֩1LmVvǧҡ˚ycY "jW_u.16yw'Kp.`! !Kz=mmtp:%2'!|/t ,5n'$$ B dxU>gw{wq׺̓%SQRB۰{XDXL'd\ r hƑC"*R. A:HR_g ߝ9#`)SWmOjk,ɶmCBcӣ̸40|~UXYqs?24᤭$tsZN<ûplcvotiāֳ|Q'uZHàIP2z#6ALTc*Z1C@WHƫM V$RsCs9Ŏkx$K;Sʓ#+ '#P.&) @nvxeU3jn=}^%ܲ;γWulc|9.0ݾ"вfrTg^}WhMwI& bM*K[BF0c"se׻_VcIT$R Ԣ!F$ D37[fÄbC|]ˍ1E2k]eBd0 3wbhQV֌ԨR}!ijz*-YwyCP+7rD@ɤL3C{20@`FEmcP:@3ȰIl!`_wD`S;_'"J%VɊYyJdVdF Clrnc6|`IH9Y -3;XWWo̱ې . cx#v^srw߾44x7nG<йRiJ t)젘!(2D nSgAE/3).iiMP&P ^c\3 :L `4+Hh2khW{GJgdZE&jq}@gs_A6u٭3qCe2u{?F{9 7)q &83pB*ayihoIO !d} Խ (sUt#'`El-D3aϕ 7:֞m8LgiLC2+ڋav"@֡!x[Jb4fc˔SnH4P_kPQa^FeCY& %Nk8Rhh6S"[?+ÂZj@}iBLvV?^% Ln;}cA ;PJQ  {0 @ewU㜤E2gb5tB"ŜX HWi,ʖKϡ„&؆owŎQj$90K3nH&ƭ!.K?. !9d"?&GFܜn|`59XP^jNFqE.b UgZ꙱(_a͑'8<ȅ9m wL W ,`Eٲ\VrX휅N6՝T6fj=i@6 @px" {8e,F(XF%0f5O{@1! qU 8WC5PVϑjѧ PL\׎!"ﵰON< } (gwo" L K,_{`"L8Ư?>FײlƹX2(DX oS7RCRTPv_{= G~v R`8B:Fٝ% ۅ@:glJA|"ELРDV NtZxf/N̪$}n:6[g fB3BypPɎ(G2 ْKe2X3&v&H&|T]ۙ4pAR&IkpZx ,zDR`ȢRȢI@LvjA!ˈ ,%-싉i 3E<pʲ֠ d "(H0 -QCKKt/ Eqb)pLxcejT݄ŭi4j2Zd2xo˗.+xE;XX+tp{m5+a8WMzjudp8fA 7 뮑b l,G<`۲eity7]3_ij31+fL;UQ)҉@Z233N|B 0,caŏ6+5>ȦXME An5beHmgjkr!P!í[ؙ { *u: Zִ(2("R*) (DqYZ$Dui4hѤ#}kJp"*!mD@pDiusypYimERՒ9%r #Q3i3>L1_tYZ5ڝ2xYo+@mAy$7ߣ}us^v=3-{w9\OSĽz/ {Vr{~M73_U V JJb(IBH6 Q6PM&ƤD#6F*(1lmM)@c%-`, (F"Acc@RQ$`ccAbhX k%j )6̴Iham`lnR}.~HʪQQ0,%P%%UݿDPL1DSh8m *' #3@@):!%E@|2Rσix>JA ^4B`6۶ Xy9wra?*TC#BFaBL0@7i\&`Bepӥk)-\|>ٷߗRE]8V(" V̪ ܁Y>V0;X,l7FAp``"+`a b"Mkya۹!E Z/KՈn#7o ڱOeO n+MD3ĐMkSc 5 7azA(@*6@P.Q-abrPe紾݃qmM[Y"XSF5d#P:j5ybK6p\n(l7%Ep "Rg\uhO} R/$,&!VM,%{r>uZi1g Zs{,o_w-woo{ Jd n0MܗR=h]B)D\08mVB1QcT X(Dv( Q_Y24[i`Ġ*(4V5ݾ\׺,*V[ݽbdE:Ћz NЩS0rҨo'_r'ktxUrW$A(@ POX0uL#:Wb 9ھ!j7 UIѣNi kk{}@߅RDɥG%U4.Jj ڠr@LW%rD΀͵TdtyKֆN{*ArR5*2" *TpC!02C[y8הDp@2Ur2R$L@˗BH&u@WhCj^Ly+D)hKlU4.<\2iLIRԁP bLcNJt&T1=RV* dLH_/4H4p;*vdXQ\0TN!ɀ(V6onqvq9s_ʈg&mYl!@ݳ5"`u8rcExŤH@aD$svζMڐ H= EBTR'ug7æ@q  )pkrΛ[qB(ĺ hCv attfȘjΡu())@8#SnJC\nFJ:5mq#ŖCL6|Lf -;ӱ.\5%h*kawqa*wR0J ),ACH.*'c?({&#;ěփUj#E1VmE&ŬFkE15(XEh"vfFH@u f5 !2bA0PDխ(D"z{$!Z$:N"."c!V ТhD$b*=9jhՏm.o k`-l2E1!"EFWuW]xfXD~*)+kh]IlDC6u^5&,@!"hɾ$TDTDbɨ>NHU_IJfaBH&b&>^QGdMҦMpӺ|gowzWq _jje(8ՕF2H9FDGs2`SݐBk4 d<#$+Z͵TSV!iԈjMDTIHR}ۇ]1 qj 1Q#=`!ntL t>Be{P>Nay\ڪYD:\o(=.e=ʦ৅jdD KFIDX*R6#52M61HFQ~4wֲzeWy7̐j16 Z`ۖ8#O܅?5t4H6RJ "ص:[M( LI[[}+꾯ok 5bi7ѣ]".ڵ{j0& M#EA50Ă,Lؐ&(oG9{pДE)BubN)a5E&(IuUmaINiu8Y T29*"f I$啥!D5[jG3oyOxcxA/+i3Uk*H"(ACgVOq&ի޾VJ"&*JKLc"&)d) 4a߆wDz"(b(ɰ@S%}$ ҾYb*2+پ6;9d>~߫; x0yxx{AAvXk ""5! r%:pZB:R[ϠMsoXF+qqlQIq&*,QunW)6Eb֣bTQx2exѢTUń*,j 1i6Uйoۃ-y[F]Z#z㜷 t'w1W'un"sH4hjW|{(T49:L1C&?zjg{hm(f&,yh7V߃g.t+//G >wG sSxaζ_ukb$J6 {뗋zMocm[׷wU{b5h*4X5(TDF5Zcd&jms(Ğ>,u^Br*"@Ao1G}o+.Ţ#DV1hhŤ4lh" S"HF d1$&J,F JJkjI jxw1}oD)"+{Z^@M,b>f3%\ugA|[(³& Adiƒ+j?k(`2RfSx40Id%YwMza )Z_|{ qw؊iITΤ}V@fɣbkznO1"b*q@G~7[-4 P* hN͖ ^h ײw߸]B .}xx?3)q <$ 85H}b|'ޝ(tk~ [n.^:ԤN)y8 i΀JI 0>& C(K&TL I c H98 $$Τ`f58ĉpS"|t( ¨B{CR*}`H 4E@C!Ԋ @PA}Q PYPJ8G{ P"( |h(@AAD_ kް  A5FMbmEXƲhRP$iY "X"IV6"Z-E +TYKM#6m~Q^*|)*A DX-6 eJ г P 4,BDM4(A #Ȼ )B"( B*A?+*4"܂E>@_#2"x=(PCeG! i˩>5(n + thZ9] TWPUȥCDG{jC1@Z}C @tQ ~S@b D /@O_}a(F Ot١OWJ~E  TrzMCm(|O5`F(T?kxq}U @վ}ISNqȇzT=t'?WҐ}l Gѐ} ES@|wΔ~TdTЇ{Q~^Q]H =s z @{UMH R#Ҁ$M?`*D89~Wp!ү90L p+0!Ї5O¼^D(ݔi(~S2yL!ovd.{hh "ElmܸzW88&`Y̑=;)C}9Y-/U:(ku_gapTtHR"Jn9݊*mօZknJ@>?81O;j+]Ԓ H@l"E̫YV:P& 0tc%%#@524=ϝ_7GRL[>g k:?xi} 差wDiGc}d j|mR;ftԨ ue:{D,s̵ }<ȩ SH.@~Ap%(UHX|T1OO =9j- Y𮷌xt¾{.zL_fδdJAǀV o 5hN%PtX[i6iAç=les]W9[拯Lٓ(mt?N2YhifHwt1j]Ac-FƳz px^K6ާ6 0S^ݮ._wѫRx1RL3!2>~gOrck8 dX&DW0c@d aqE SUk 6X ~,-ezZ UnZz^ETbĴFJBdR Z.¡d‚HPXçmQ~ 0&?;( oa${{قbm" P "*)Q- )bRHAIĥ&E ]H(ZEiPidҬH(rJ ۔AP J*7܏fqÉP=fUZiIb() (ZG~o1'|'ɗWR<SK0590<:&WO9Jhd$=e >G, (HI]W y1`0 0`"|ڧWՙwRZW8U:hU[ߚ=󗲦nB`Mxa"KTpFy,v|v>{8qI5yzX~%Y5, s`,n߻һՒ+<ٿi%'~Ja>[gw\l%AH⻀*yW`5!KiiϪ 3s4zTJ} $`#2#32벛z%uNZ* dc4 ffF`Yk&5('T39v&uN(Ҫ+ hòkm7Tԫ,a(c`o?ĪZyB)aKmB23MJ#$.N~gEf TmqڷH2)Bo}XN&8lA';mC?sfTm 4hICg3d!͙ANiU`8*\0<,ERSfT!g*)J۔Ym4e,}]T <Ͽ ≠:/1x;5X0e6@e1O غM?8kүƷ ^}/DK,(I jKuM~.tSf)5u_Ѳr45Y۵}6?]ŝ 5+ Aw~jXETbPC?JalbfPs"<*j5-_1dmNq䫻9trN:$`9qNmVel4^!V:e*6.DV+B`&,z&M+WrV`93!5.L&n' sZE]#*/XFBؽ)L뻨<(Ǡ  ˮ`Evo)f@>^dǍWy[OcTt8jb++ettf4`r_U\OG]GZt+Zc@ @iïbuinJN:ͼG$z3lý"ڣ@sb[\D,Pq,$9}%c1F /)*ИgLsLWAL:P T.w.6:2!ʞoMCY[W[3d_*NkתjewU6DfOeQCģ%yTIy\[l|/7?kzer$>ڻ[b1X$:eۂ7U `crwjO܉w>̤D仗jHJj/Ed?f6VuNн3R@)nuWN]fU@w@&ְ(};[=7-!klW廝X^ӣwzSS6(yIۢFYAkTl ~ŒZerZY{AEEn` zzvlf]UͪlV-<+~/zۗC3kg΄pE44DMi^8v7Vj 7?|4ڵĸ@0Z/W φQݱ^i`@}6E HH"‚S C " {M@`O?D!CXf[m;Ezm7W_otp4HTTC޷fG"@Gؔd@w0|Em-,>1gL8;Aq4y$1 4D{šE 4 Ϗ6L=Ƨc`@ *cpx3vE?* !2'$ ~"d4!yDQ=\5X 0N'= 6=mzo*1P*_jJ)i\sǎ;owp=7MaנAS\k [4@Kyɇ4G Q[i Udh#F5RҪ '#}7M}ۣuk}7a3 8 "bUDC:`푗feUcd D %QD2AJN9m? ybXE9tܚD Ni\bG@DO"hDhp+k/lsy-}\R9W+v(Ϟ|Q1>s E v8wc7 P2\Gu>"”hefMJŰhUe 7!CW(cBE`E! 5w?End.Z! kop˷"j\Y衼:Nm 7fpmԿ9}֠Ҕ6'N/LӣѦ} /%MfeBM `(H/lJ>hSRoJ(?/~{\}OmLn6w/DA U$b ]@w:p͆ͩp 6d,ؓ  ўF*WDC܏|O-U M>FN?30BoN8 <  d2aLD"b1D,F/(5"I3'NN'#Q+xs[R63 %)!)"eԴ zWf9Q_Z|cm{QPeQ?fv8QJuA*puro7XALZ$*Ӎnu ?ZK .pvwq*hT/sWzZ]nc.tNJvɫ|X}jGRl^P&WJ^w`Kk~ ='Bt5&5 Ι=2LfdQm' YL)0сhl:׵]>ڪw6ՓcχM2^1HNml8$S$>If\(]v]+-5S"5e9nEI FcSX p)dzJWTS܈yx?\äom݈BgI.r˲onY>z<˳aY J?#oeS4A^?_047DXL~~~O]]ϗ`ާ&G֠lL5x:g4NE\J7e6ad{lwm-ym&e:K=xt}iB{ùߤLOgr2ӬjBβ}vq]c(|}~ JlQK*ȑeP G&3':nϰ$0=hH\C/jr g(4<[S7A649)1/N4!8LJ}0f9$ pLnb8~n<"Xr fgp)\;T 4eJ!nERpI;Js,hf'"e3&/^_ɇ><&<'(A^ 3In#љAS΃u{ aCs.:˶aiUN&A 9J";Q}AY&)8͌L1 ͈bP^"\tбO>rjdmw7?U^_ +Q (H q@OD>|F~p,KW Dյ:\+^U_5 & ULrdŸE4ڌPϗa۸E*HPAqaȇDB)NJ^rVa=+qӊ+cG̚]ݵ_âg, ({ u@/]P,Q@pЛp;ɂ%r - ɇ=ޕ4a$D] `xzu/am\HsltyBn+G] X@ QY$ A!rS{@kBdepxh2_/ѱb+SL.0R}Rh7!ټ?1j8rKxH"zqi6$-Tq@nd;03z pF!>+*,h k}y?J4 b.2fŘS&twMԤl΄jd=;7M ykB13gІ 'yl=o_FU>mej#mDZ((o'}GhS Yþrvk"^QwO z&.[+SJ)qc &(7 fgCr2goc|l"o43 'FFHr;uDF~@ 0$Q=( y\.%i?ޥ 7{O+U6!  xl}tܧ,iŊiDʧUּTI<PWrs͒=VOlOWoff񲩶9 Țp>]C8H&MD1 M͒I$4jϨJa۾.#W:ytsZG;qsd$8;? =Z%FHA;YY"լ0ԫ@ñBIMoG9bV3eK>Im./mvul"4RMY5_QBĠf4Uc(  RU57L\MT7rD64 7yN'B=/xwG]d%dUfSL^l4J%@ٍp07 XdP*ØmW lBTuwCV%xQ/eW>$W c WeYoMr2kZfݛ( p:6$հfvAruOnp$ yDhw>kї'y dwh=߂[GcIn?ݕ*ۑ2#ԥFvF]nj77e=%}Z)sO |mvMj<n<n?<j&t-=E?]nagxOa񕿪񓒯wp+sm&5K?4-|cʳ'ۥg990RxJAY͠vɂcQ $r7 1| WyF5bC GWJJ%RG0 {aM* 6U\v |f-۰?-ZJI?^V|7㓁URjS1'uzAW>UŏS熹+1͸)0ȳ\k|-WN )/9TZ6OVaZu}*?*s;t7zs/<ʸ*V653gH 1?%tK5qmjnl"~U>*=H\N!"Z {`Sg.ƭ׭;oED|(&Ƶ̭ԜCF5JH?C]^ɲ,SIgI# rP[_R4Dd$#)!a_߿u˕)'P_!}H!˗->lM{fq٭Ztzχc\:KAmXY# ~O`sMKfN3UQBoq4ehϣ[:r6U$&J|q'da{'d'=-x}V@"h(qK"fyq-L1t$DŽ\߸;>fZ9U?ӿ? [ P` #J~ )"∦CgЬ|E!dRXIK9bZiL%Z0_}*8=G4x f5y%m:I_ns+,xͫvaOgƞ,h{ Ĉ.U@ꀽVnu-I5 ʔ4Pi[ ^ a'[7~?0@ \u ĭ:d՗nYѭ-s b$.8hq&Y[tGh~|BCO!0H"Xuy3v-n;쿯O]d4HQ4Ϲo0{ P\~}cqku/ ?y¦h(}s]m. |q__?zħDCͪYBF=yv;wBA=TPבW^syHx09J!_9k}aM]=K2(Y !{D<w4Y=6K2I`%D)zݔӅ%j-*b 3S6d#?۟v? g|rrE>=H9]T҉<antZLڂf'Ϻ?wY<*—vވi-1vY㳄3ck!W})1Yk&pҋ<-JżD鯳yEB^[vs!ϑ>іk9xע֡ΑjjĮuaocAu=[Yl]V*dLv4立0__{|~{2߉ew5"H~]Nߛwq~ܭSviLjB]R\9|D1ۭ7~X]ڌ'_)3 s6pZ-(5li\ ;%fGzjz. #=5|(K ygn{Q>("hn@| ߏ(BR% )?;?__tD0ZӊA?;UbB%Z^'1}^p{oճ|9>e ~HBԹeV5oSnX75}wȗkFDSF}^⮸F@K~}mDz?o~wʢANJȏ{w979޷z~lWpވϞ_۾'EYW?m*;8UYcg 5yMT'EiF,tAMGJ.p4H4>cw[2 -ȀgXC6`Cow}|uUUL79pz]ŶV@ƫ#:hR]B M=[i>HF-X<~qd^?Qx YBgycnw[#:N*F[C]T:{ZuƊኤ> pscR~,1j9('"@>Nj!rw4[b KA |^ZbA ylX:M_3L_;#@v*OYq~~}lAÔ'yng7*!5}Oj<;aP`c[,reׁَ}U@D@k^i̐4h܎Vtn&c5 Ok?BaS${+NQU̧nfF |Nc''' =<_nz׼3"kr~C w73$ 8=_ tDn’bzqE>jQ,?6P$J:T#!@غ ~ HzҀ8RJUJnr+WI$5`ҟ=aT8) i2@!Pm̈$&2F]hie}@HJ]xԖbCY2,,T\FÐ J$Ф4I,IWa>XcZ3Z>wT\!UeqO~ѳ@FY?KeB܅a_`Bt-fjut9K'ww]+Eۋv.JWݟuLaa #4n)Q= )B"P(Rؐ2UhTP ) @y+)7M #%*u`@8 -/b ]TW7k&\ LxEh؄h(i(ВJK} lqqi9N2D*JX b=]lA8ȁ N:M#Thۚm%bդLʊ,m2TkjAT9⅐ lyqK];J!2D;@{5BN/^/SoB`ƥMqJ瓅 ‘EMJu4&`!ԀL(R5]?mk7\44;PTU%*$1*UӔET6B"T&P= P0@ ј ei*@q-aN5=ab#2v(8dK [}-bGZn%[ebY鴊ɮC0s|K  T uvC85|w}'#2E\^>~gzŐb|WM8@3;JLs}.@ Bi&i= +~hG\؆^Ϛڃ".m^ߚ_ox;s527qX302--bms.Mwďe8^L |~kAL4<-_;ղ L8)8EG)ƔXWoʹ:aM/,5c 솭qȃT.ooUz*fI:'vJډ ǽn޽̥\ <\Elnz}sݳ3r*}uPTz}?66Gakd%5"mNC| D`*4&(^$^C_DH_pl53:DR!_)7y8,nWb9(|Ҙ8y [7]RMB]Bs2 [1OI]x忭C5kkάEz#Zm)$,6NJ߿7zy@af'~?ٝLZOک`oo7u2_K\WZ|Qf2:z~JIwCttlܶ0e MM@9{1v?leTf9ʫg2)tQx6pŗH_lyaxߡAfi9V{c"4gaC|G~&?Z,$٨@`bg'>ʚ 72OݜZTO$C2RG^MVJw<˹k %k)*;K}Waђ4d=uE4Tz:pc=(-d05?)@ 6!:*IQQpluy4} ) {mw𢣜1;yVW+ͦ;YoxAD8k u-+W}%Rv8iJ%ĩ횦b8yO ޖGku=/qK[m{4hNӳVņh>0$P gcE͇[F|8t@_{Jeϛ@g]ᤶ7f(X^ZzPTQijjp8('0QMk߾]_Kp3һMnuղ/Fx6+ou͒eq3'EЩhqͨcKua=7ԒBkEO}ծ$[ZkT+ǕWg{龎QM{b8ϑzpP8DHxK٧a+b!J)F!$%/= uPјԹH TIQԏ:"qpFiBzNd^zvwTH1L=i޼착J0B%LǃUϐ 3KEł=ܻYJ7/aײ_`yz{[rz$ >K#S$p  PZSw`0 s)K|u,r7i;}uPTj|<ӣ<_ȨM?Xнwq䖓EѺ2GZḧ́ހ7PEV>nBY!۷1sXµѰDŗy0%q[]"Ph6έLȚoEA+:~@3efگ{$ƈ@ "/p(gT\7OD_?p>S<Q@Q!ztċ%;xB%hL 6zLJ?jI5)AD^:hq,>zJވ]vk #t&4nSE7@fƦ@TCosetϫg?z]XLʼnKؼgU>ZWr(7-LJCºewK0 ;jYȓ1'@힦bBv QfV;ҬS+2?}(U`á õ{Vj@@v<ܫp+L]L q@wo`Vbqa;00t. ZmϘ9hc$aՌw>gzzndU&]}U8 LP_2D}L8U__JD9.72' {Q)r, J6#8Sb-->X!yI 3x/ RHk\hi.:B¤tmI 2iq]Ht\E" iΫE{F ȑB3֐6>`O68i]N'!PzrUxwnEDE JOEf00<[yw4EoE<"Q/:~K.۫N]sDw h B}w P6p/sO #D n{;8 Qʔ0"JOrV=sG]<1צ* <;XWRy"Cb#'=  }׼D#Q4Cg}iݡ~qQ6#t6o{ ;(V-_taT0O*Wsٗ&Fs;.p0XpTi%@}'_L"9HxZE'hy7ߵ^0ð{Wb R:$h7[v")e)TZ)_6˼6ͱ_EaO%Rhrj m&Vss6fwEn1([y̍=0&3$"2[ZnfCff%`;!z\֜Kg/hȰ_EpͮXs1dڇKAIZ:٠kGO5QYa̢^ ɷ-6[ՐTcfՔ]9Ce Q//sn)'Lj;3L{WRAֳ*BQ0wx1of{e 9D -1_`_A6R?%Kr0jio!HH6O`+m8&v?"5*5R ۺu'S֧-m9 j_xװtR^1ۋ TH hI7PY T(FTc.*V`}o9 j+e<[DhTMLpJ1pˆ=`ۊڔ_ݺrbh۩Cqsa_0|s|եDY<(u6Hq A+dwx73Y<ŗBqTOA R]7ោͮł!OXE?| *iH1G}c]Vlf8,[7>a5ڙ[ՈGHb,Ba|1,7a2kA,G51Iy7tIq@T_^iXOu-7UG1܁ }fSBNz3ls1 KW{o@˻'Uk)i*]%M{ۧ1z[YU=)+(ѱX2:[)34eSO(oJ 5bzA anyAw?x?$ٜYog%C3Ya ʺZ[38&YwVhM'˒)OxY?^4=⋎ź .')'^Gj *-1PcP; Tiťy OK׫*#,!od,6A~h tVVl*AoQ#\u{KȵZ"Zh_oϗ{i@Mؤ3~G^$Vt 6+.V(pz]ţ'֙Fߋ3bR4BJ>X!b|1A.26B߹O8X*G9NAH,b2J12k\hUc,뉤@vJ4x ׻h( 8 HH@|$T mCm)Κ(~bKC'm&%֐섔PB_D*JkA,e㹑[DOjIm)ZEoQ2L5YUpU^aq㎛lLǯq{'-է[EU߲TAp ";:| | (Цɻf|8K\d (L %UK%|:y4dNT!,ZrvB^Qˑ$ 4m bٲQB9NA l掩`"U^F' "mXݣkX?3<`t"Y}q˻1>%6Ѣ(L)HpK㝹-'!jB?䶘OB,H1 0JTLj.L([ŠeMs0͈vz^ ö?ez0k|3ZO)BϹE> %Aᦀo6E: EuwdL} 1Tتh$S]+Fw7{Pą7IP|SXh ު@+\{ ' a&3,K?LvXBeUI.\5<޺@U Fn[ 2XwU7|RYIwh٘y{MR[$&H7гvq-aՐJWiïtPs˯FMi!oAZ@Mh.ig8=v&Cy]*5??gEB>>8wnq>\u7'|䚑h:x `(1L떊a*sH?KٱY`-+ŶӮѴsEu]&#<O*8Cj,ysq,Ry&mߖ `z܏0<肢voct4EjE7ۉ宐R?mb V1HX.SSJ>IQ%h3u'P=oWTǂeXn|3ʁs)ARۂXDAO4hgX Ȯ{UCf9yJow;b+aXKŻv]Դ,:Xg,Dݸq$m11ܗMKv1$VlRӌWL(߱ <zNJJ(dsLbU/A KFZ<g^=&df~w 6 VmU[^)~G~YS~)¿O~hT"*ek wk݅"55$n >W^PZ^ZLJBVli@#F5ҷ ^? 5x#GR6EB`>1[|;:aZl5v}o ^~d+~ݕw gsW*;18h_iS*!EֲeW||?c[YVN}!Cǔ *fV4cq4V|QRO>qrO~C(U~Jf#]<ze~ =nK"t5B+-[."[K81lIbźdkz_[T.=pޫ.߹`M `ShӅOL-'hE4":y  8T\d`#y=gD6U9[MeVos8ثFPa~mаoc |79vAno6Mhb~)$8~W`_5*Tks ̻vdSWGr(5kB =>{>ѐ332e-ՍdsU jBDO?BKP,CASۖސX܃!D`Q5 M vnk^>ZRYs1lypʹpKy=itTh4"uqXvu*"»%9tH?x/? ?z Lqi |5؅5>u9/VEHDcal %%szTx"LV9]}x@c4l5$98$dYq`F<:J].^^K˙x@V(C Q (9D,}ݧ:$H&r^$T˺Y*BZtUP^C8@qگ\$|CQmn+P4v: Д͕+yŁN vJ'l3N49-7gώg{9 谩_SdȫJ0ʍ2&neH,'F+RwU$W(p```Q@w-4vLFޯ& \RZ{VY>brq#H|<&f#uoIp j%q6^ $Pz̰nP @sOقAJM:Aw+ 4m+]HX1tgLh.7b$b6x~D;Ό/,:ɐG%נ.v$ٰt]5 ?fa`U<& M| SB{(5+_թ#E/ \0&FP}9C!bn#^k&]ANvr V[4hJإr߶gӸڎ8'~#bv[J D +s<1(PVĵMpXm k毉+[) NÂ;EcaGE3BII șߑ\laqCq/%gaX#;1˸zn/&[ ;gxIەbFDIݼ3yD̥ǧ{` 0&tW#Bbx>&)+`#x=^1E_Tte ꦏLOV#e;z8@Άz*:|jo;#ԌbQD߅k1KGTL~q!m`Uش9X⒄T>۷ y,E2OKGV)ۺfK~&]L?jZ&Po~b %5e\%@%U`.˃htE DV:=a:B(S==?V *^JczJj> *70(GuUq =oV'[$%jYwr[,VMadB'mZ&`\ci߰)R-!&Aى·_LrZF֚.SI!KsAgLrJAgږO&C|ajp& YĴmS=Z6lcZGPLPԄO.Gq=b.&3u{DkTN`@dp7ʘ4U~puOryI2qYL;:P$wc i.)>,&ؠ$0RByx +^M+jv9[Ks[{ޱ~Lhgmo Fd.G-ޕmU(r1 n!l"'ڄ|P[ E wN*hn[wq# C/& \kO&Vvi`d׺;0U[[۞iKș<V\4pE!KVDG/PPV]TiG<cg<%q 7g.NlBW;ہq.IcA2[0) 68IFK {y û' ߾By+Ÿ3i32}>k)^Vi0v_ eS>ζ0R8ѹ؅]RbNx#h1պ *xHjf]ن#MDL1Fn ߳@jT&{:]{C;)4L QPZR`('N LD}RDpFYΛ¥ >{zHȁc6+jɤ ۥa}T3U S2 >WG"ѫ(U,`)A)#:*H0i?(>wz&A {R{׫f Dz_?J'mUU>mh >[ 44S1̯z/ p#B:ݼT@}O &_u q;#/_.ndOH -;[a_)n4-I?bMim!ЮK?#(B]l |P7EBxb g1TTG@sρ{C^$˵dSGߟ2 j(tEM]o3;tV*p-;,$̩hTVkϜ' b0CPrr T;$-AIa ¼ cՔ4pQ=i ;C kU2|n4*D -t5Û`{L˅"-߹@,& A AuzCY=Ҟ)J{H.?X^(ش*Tv)b+yT[~r-LkfL7'%lDɾ\sZE$܇FϻpfY!qze VJ(U %eHy7|S+vkw{Ҵ"#D"߮HUn=V!s),hjGy,e3N}avljj^e#g!ǰ]E. |< Ku2vRnZ}U= Iof[{Va{9'x?-Ȋ1/)YgXCFBGb ճLܸ7|#׷ВPg$?qLY= Tk$0&nmCepSRqbE ͑Q\ȗ9UzXU'ǀk؜T_P&(F :g&^@2s Ta$Nj˘Ե'x&Ii$uZ./.ql*DHA|&xdYjhxP>;/܄tN8,@j `eYC5EH 'U#CA BRa'nL+S;ۋmUCQjm f!ґ^NxZT*&ې<Ԝj"Z{--\&r3&As69f9J\{Gmpy$Ki`[zxنwc,L#-pϳv#t9}"yޓ: C5^aޢU7{76o8 DLwZƈ?q&P9&(LZ  ( <($cį)RF+Oƒr y3#hv. oC[A_RE$:af&mE[[IR1/Ѣn~ն`~Qykx&AuJ߇VzGEuj=˔$̝0}(Ƕ3bmY\"@4XS1I.!Fb$%NK? ?6~<FHⒻ:1\j ]p n{]xкf g ޜW甾(%j2e-c8+ؐOS#c 멯2wnY z HM4g?w $^Ď|!EMi<Դa%yOBjIMYvGzdCroUyLbO5ܯʆ lJyPi!'}3-?G[FH>!˿v'c맫{F\fuy#xKo- ]'gF wLC RSWxm<<A3' ZXNX v@+EBd3;9 LwB(L5R9,ɕZB =X[wHvEZgi)}B'˕NPUW݅hy#=bGqA䎣<%R9G@(m$u;*6?YQ}.*aU# AP(@5w_v < š 8̶Zb?-r!M\܈heZbMScB1y뱱[Vҡ ,XHSʕMDDZ9CQyvER:6*)2v/zr|澘)΀](%,ۧ #vQ&q_UB =m6#gyKyڢ"x?晟(,AC= AO܄Olս,qG$" BVRFCٸ%^f)#P_][${㔸.跠"AX|V]8^yOCAp6gˏoҝΜL o|i+\ZT%m;?=pdtGہdG̼2 [ ]K\X?V5JPTEVo;_Ivܽ)8R8'a_;hIн550;7$GԢ*R컰X>{5 mpy{V8:S@{ l J.Nj9u=JaSXE6I5kB@=|UBSXPW9k%Rc|+ M4 =\Oe J&p)6pP6©wJ$-Dq~bke(F6MZ_}P;en k!/s$˳u|Q"e0+1ejv͟&WG)#@$yUMP:!JM_d^889qi6HM:6{vl1#fF;v4r|KGyUu%ӑ߀+qJrg*2~N_4^7JIe\ǩԮ191JU#C{L%9qM?gs՟isԚ4J;oo'MdڬYx ynЪ?̹r}3S@۵uVDU:) yZUEB0cX=cՆ&-1|i˂ >stxEGz7pąsx`C{}P&Pt|¥;pMV<4#ԩ(| t=lBJy|>q>kc0'u㠜P߹ry$y6Zɇƣwg`:ێG?M[Ÿʇ둼2K i+(Oc6?ڟSom{ԇAu8f˖گkE1(U@5QѳmۉU20w)0'?@`)jFۮ-B>X7Q~kKF&EuBŰK""6I: Rѱl.%"6X" ['HUYVA8^7>7(AK\[@{'GOyArc /:_? g1T$J<}u< W m 鉈v O¶Q_X_:5?Ͳ[f_vޑQW})lMKRVL orWȪ^t!^IupǘBV3P,,$_$_e=w@35: NH93f ~DnٯGۯ[t(@qmr[d(4F!tg%dRP6oQv>fіt c-g;f9:(1u/JcGo%QD}̢_9y?+{NûS */ UqohVԱRXV>OSR6Tư$c Ǚ 9do4۽!=%tK\Wm'⟬T7 FNh |x zT(ދBMhlDxߞ}Mh78L}dBxm Kj2'<9]yn9M'>cԛT?!ix<6Ǟtwq-wۥ5Qg8ac&Gلgr3ᾋ !fHwA;KEMۚAz#y- b{Fa{}̴\B4e "! SG+RL]ȾY1Q~Yf qM`} F1aP% |#!i?>6nco0A`4xQ]G "p$s k%/ޓ9l 6 W *d%*_)(HJnBӆ-hX0ūCgT{N}m ߉R2QTC!@':y*4&S^scY{7;03~9ήWI.PQ,yMi9kO]ݽw.|K'j.Yw2q^A7/D Êѭl5DtXt7y8JnbbB W 5ʜ(Y`/%I}~Q[9YcЯXKԑ!V\G|Zjrՙh*V)rA?q%"ml:Ưm}C9|! mhnSfٟx.WR34?>glȂ8/Pk0gHzjT=뭒C2"Hjo0`&dߌ_%>wI&nw(H2l"hK\l.0 M|?BjVO05ibH.UV_ 6ΘdB+ScSf}ʝ(cAfyQxoIXWBUn)TyCp*6Ljz$p Y:]$O -t 2;(@\*,`NCCr}=Mo6bTs4-xNotE# ol 9Uo Tw84f*1C7֛76NJt'92eϿPiܯSmz^2mR.Ͱcn(I|4ŀG ZK&PиKxDZ|#E1c 3KHv1 ǛIGs0 P + -QA%FAݲ_K]SƁԟAaIAaR/*(E9vHz)uiASDJ"Ϣ S}^RY!&6ͅ^_#{x#a@cZv5_j IoYhWޗFS{h/S ųynY)SjG';.8Yxa+R 􊬒_[ m43Ѩak[Gi;ֿF<ڦ[:<']l֚ /!m\Qt)lwWZؔN: 7}Y2Җ`a&}7܈Xp7Z֬vl&3vX7'聊 YrA!2jZ]cnL6K.O(;Gz0"6sjҦtczzfe!^WZP,lҖ'8ԛ$QBGMFfּWjw.9a!e05&g2}xK)Tt_0ކZv*|A#TS9L+WRz1uyF݃%k[Y0 ~4B.~<޶w70}BYķBw^Bɽ.P')sȧ\>6218@C D|`< CÂ5g<%ۊt`sI~V𳇌3Y Qծnz&~h\̒hG0 RRT;}jHL9 H?I*n @`}܅f|@dhhO[.ygEѰO';u2)'&bx̆g4}v1>c7L;@jC٤/Plvݟd. U׀Q+N 協#}G/v9 ~tjRZpEP0)kOÏ=ϱ_Ǝ}z6/e۵urua',2վձS+ZqD^eam;]omE!SCpf%^X@⸸߯P'G*XIQ@٬=ۺAcd6d "j*W[7HDθH#(V"T ;g b8>;F A9l µs~YB Hdf6b誑s ;=nhM ;>t\R 6P3n0X|(˙ CH^ၑhrZ֯ 6aC?C*]T MoxNJS<)ZoR$I7Qb'Us˞L>-}$]$j !Қ({:g=Y9CU!'(n9y0jɊ.>H  [9#jl%3 [Zhħ6ς2Mh92:{7'h}tg0׉"8هkԻ @ !Z飙-:WuX7c>%ɃKm(Zl sgZhau1p~_J38IpCWxmś@I*|lNV`6 N[:=Mty*gGB%l™&Qq\ 7ob\/iBm{9ꭹ5c>9kQH_i:`]9abђoR+v +wdAosv&#>m s,Ah 0!K@:YL,xrϢ]@WMέĿu+ŶijvM,L+Q(ZG xO(l"GḀl!j;jԂ䶳:V*>hZ<"M~%g]!v繦Q1;Ͳ8L9-DG_U~% 7w!;ƞn9ʌ‹,gB`h,Yn, }P6EFG4m0]3Sl4\K)f.0aX.7:1",O~W_E6bE.( WzvI ~$*bwf#Tj-t߽g̀z?;U/S5G4fsѵp xJ2`q"WG:U7Ƒ0;+|GGOm0oUЃ!/AQ(o^3CΞԕX]B ! +jje|S]s)=ݣjoy\2A:}Ϝ7[n1&9ָ#t2tzC m/ }u{w[\=qebzu`H|E W%5(VG끺T>L*p&wS!*LnwneSUʭA])`kYx []zD6zA"8uVcm(Օ9ջ2o5[ iZ گrKBa,MSSTB7h1٤V#`EO"[4hcjHy\?ӭ۸:y#xb|{NȲ+:_J3L1*@`Τo"nпo4{%n/[ zy6oe'.&_Tc.$;3twN0'pgEB[ov$^鄂+EDL''կ;uI4v ɘ%GVj qPزO1oL nO3ްE'H :[>#iU5[XL䳽Dy; )O?F&S&R$Bji Yw4 aU$$ġƦ]1=2\}y#^2' r9LʈD`=k_Y,oCw=QMN vq8:宜 Ol6P"XzHrwV׮ɠ}XBn'.46!*T nU2-A*~M d^+b@L pІ@Zt )]c̵g!ҭws)K(K6gGȓKIY]%׬@5(cLUF#5k\]V- Qp'ꫪj"6̟蜟Lz 4CrhԠFJyA918ߥB2"]bfxIn Nkf:b+@D% ^$4dUrpɘ+!ٵ*)+EȠ0ƾȓ*DT:uz:ͧɵò詔s+~zJ_F+5Md7aFCVvK^h~3I4B$Nje9φpacbTR'c) ଇB-;D&Yf s}ǶoM3,̗鏊xgn3¦#B1 V15˰4>c4.ocVrFm"B`P06.y m OeN,TC%+u |@4ιHeͅLZ@t{53Jw-ŌϦ`nJP]5O.sˡ ǼB" wr6)(^Z9XcDtV˅DM}@T.gpo5Wu/Yw(ILCrcpNwKW=pюe/zܶ#_/S8.8˕pȀZߨ6ݦNOުZ9f}Z,vlHJ9-hboKCSLQiKVR§RAwEK=8JzjnږPyt6$>yyxpR&`*nKOÊg^ݣGQ\0YzY*0#/(swU7(vi=#() ~ lӹjUu MlA?3Gkxvpn3 4KlݕӑLoS""$?Ek( *i1.x?A!i$tp#~=}q !Aޜmc.`4d]JhƌXt1ج-F@I: 4hj30Ew  N"F/;s:-z\-*AdN44F4iM%M#\|Q[3b)QṂ?ͮڎԐ.~'}{O(/TlM U~ њ7n#wJVhdICrπB,]P&lPR\vk;`X8-~KTgP2C腁!C#5F?|&L/^뇐]v5s{zAFO8 >+FmOF$ڒ@NNז aeiL#gJ}XiehէkP Èye_oq c '|_ZvMh2v@XUPaT]ڐ_ZvQ;X?m o󴁉ƯHF:-=U8&.HPu7tydq5 F|돊"Z\m 'ڍ-cT r\ՎQ&b(y&z܈tL6Z600X7|`'s QL{w}JS~z#;ēepeݜ]\T9δ.L>tmZ߾x6A5$f6LbxImYrnSkdݴhH<'E<`B!Er N<x aSW2y4B=b{M_9Hz rW[M9%ע|h 'Soog/֪j E>(k _EX*+f5>~ݫv7Ѐj([VJyyWe"t|2Gs!$KS93x614ߕu'Rx]ވ?@]U ے>U6kG6` Xgo&E` ~uL-d"m{jqcm^Qfit.Gz)zY(kzc Lٳ7;S ߂UՙAJ֊PH͂ RYvB1X:0| zǕ[CY5C #0,jQl\$A)I<jxC6E}&G4 Q!*HRfS΀s\p Ź`D9cc? <{b"dvVk"2.V}²Z>m*8Q8IRr*WU .Qل f _,mܢZiYq֭0P6 G h6qkr!Ej+_h}BG>\.j vH'9a i݂V}mFGp)gTX`p=nh9ŞD{8}fDRW*h{3F~6YbF#@zҟ@b a8x wmؒ:3W@-Nletb?mB}C9Cm R0mp7ZwEz-{:ѱA8ߜã]oϷstB!> a%^ߣr_[\>ɕ)2K 0Vz>&/K1<]<)8Qp׷vtj^O󙰖)Ӎ13EۆEgvsaפfjdEqKkMp氩8+=9]1NhQF]z\UT`;$>%2JhPC>?B-;Lne~LRȱUG &(ɮ'Jcϻ2Yb`qZhX 3`sbϱ-@i',MJ?tᆆufފMT4;AQ?c|vV@#2  Yԣ$,BS8%#RQ 6.s@AFw*;ɉ'NGnfR{}|%gZRbHt4iխufťPWʪ ܢU?=APT`>*TJYx 30|kЌ  FM' 3DmO^I166<='2;'T| jræX9y`LHX$k$Tۯ}@"L _0/8i6U*ؽe4Ѯٙp?zv;ش )PoqabDe'޹TҜꃁrnk"]. k?Ia+){"-Ecة1Te\J'Ϡ!J%!+PΓKHYX19c׻AT/)L{X?'dxHi&}AV#7C7ܾWk ӗ^z'%lcih ͞^ G xucm1ժ$䥄,'0){?>zZ4tli7?.)./uы2]{aeA\_T2=Xqx*ED#r Gҵ넝qa9ujy76zdz׵8&oڗA{Ot:{SN5kܪ+Jl]8e $&~̜w\&fH^eIl0#b1&_gĻ"Ilɔr !w]B.s9󝰧5-"FduZxmn4v(I35Ejv#0]aCx+: +G U={gobW(b8`5%B'n+I0y3v57lIϋ&c3t66QXD", ުbQlkF~rp/Q} b OM8HXϼO7%ĖȳM|̛|6b[" &鸇L)JRΦ{\a r3!zQ jʹ1 k.Lz&MzQ94oip0z4|BȞ X~:pBGMv3s()MT \8 \QPTв(Pݩ{U{GenR;.iVCp˚}"A*[ r&,`9˸5 puF!YH:|@`ΈBv]\$hts/.<Ů\?=^1?Q~TGHj8=.J!"Qg2׻ٽ }Mhx4ڄלЉ/+`d9^z޶ŔFȕa*:?IJD+mggJ5u0/ٿ?`dPa0Jμ\~ 5=90J4rs!}E ?!ʆ9qZn5S 8H@q{OAa6<-5Ɇ*z";Ǎ0`Ë`QAP0z>qa s_ 2µBa[̐8жEɕ͜6*/N*Oė2GV n2^l3e#ƀ_R` Z'&k6^"X/G^*8Fp(Xڗ48`l]$?oR;jVqE5%Dk,J[S=p?ߜl4q^ [IST0_H y^ Wi[HtkB%$q\ _-7V)cw<ĤdۊurFpf!{c &"OwH7־h8ۺEP !:V?ϖH3|0OJ#9{HMO8NwOhFMK<,nϖ^Z<%H Q7a`D?\hyzQ,ol/j34eYe#h 20Pg  Y!iw\b,,>-ֵ篕QtB!!356Lnyvk:x0 P+&\fa';꫼3R$4hB' W!#N?p#Ouc6D_NqfԄ\mhzWA9ppxagCCճrkt[H/gaEd%dd bs.TF雜?sU}fкLt܁p4K_=  |O)]HX VY:Ջ) `4eC9WɻH}zz/ŁO|;V*~jn0cTNM10}0|QQ2(aL(pl}4צ<:ASL!5HkY"Y:U`;x+AwjZna[c>i66.]l )h4s%CG6?4ۍMK;vdv.4=/ C}EI :^>@%yE4u$[쀎]nU%49 NHeJHWK[Y.Gt5j1YաmWf7@&Gx3l 9` 4\A@\/-_ظGoz7(yV nr۳Fl6ZS^b&3 |6GUApWvMhf.Z+.5_kNnfSZpX -( j-m-ս@eP)qI}p>A'8Ȫy2pCT>Һ|DxH=;[9_:6*0# c]-BH)ok-S2P]Gmb~}+~qj\sַ, _9/ᛸdQ:Y,PP:O6oH:D[ IiJ7Hx ]@W1̙i<>|H-_Y1Q9db~)+0 ,?9xXˑ{Nv0q_xp j1]52RtJ➸kA,=Du)¯Փ@4Vݖ.}\JQJ<'l˧q86mRvnΦ ^1u@*Ywx}t흖'wfP JA͂y5qRuSְjÐþc tPLfV ]Cx٣(ǗSj/SI}1qV c#0CgyjKBm7BS˔9(?FVN׀[w}uZ2iSЧFB#q4 xp 9;FV‡OxpX+G9X~ӬG)GqcczR9ƿ~t ~H(:%2LǓJqq>XjӉnnϙ?!7 y'XVcfhxD%d Ui`WJg&P.p'cq?668tB:gD0jYS. 2FQrHn|b71bZðтޭhrfVF<{:EjIVa?DXJҊE 2$4?8Byo9Lx.WٰyTI V5awJi>Zҍj>6pJ PӁHp6[ۜy}FF$(EīT۳RW4)1͇PqJXwL=A`m/=T.@{MQ|a͟^@Sm8E+%ri@H^\!BTr : Lİv_岍\,p8 ٍ=4"g=9)XEhu"xη5[wc6VVn :O[PӜ 93TB`NZp@4@n &1+ :zdi{JCأu]V#^*=A <|+'dYGc^qw4.d%رnWyITPQ7 "鋕{}R 6zmZn 3c2>gt 14Q|kl%t*`Vgyr@ݩ5ͅ\мW?&d ` Krsy3IDon]>seOLL$9(p_#Ԕ_m&YwX"X쐧_jَbL14grɠ4'RN qS-PގCrIxb/-Z`x~n%Vo!GԠ ,L߃ ġ^#`zn顆M{n8ϩGU{YHE֜uC8 R&ߵ݉[in|ފZwMUXꪰ4Y.]Tf̈́v캸%2Ģ2U[YP,1o oOB 1#ak$,l ţc~xnLn%i @krLrȳq7v{lHqnafQg˧Z)יEu$%X~[-d*Q䷋%tR=n)0jFEcJB)/ꝇ r4< ,S4;W̓;ہz Bo_~i/JzUXd_\4Boe2eu.!0Kx!oZM+ C cQ;?[]G.͇wcFToo tةnIF\1b%Fn*rC]a1JW4_UriJ}oz-s6i8`@ݙ[9ÑB{} 4D4r> P8hT p[PhW")~:(ֵ${%^a)9V  CVAcXAӅ)o^fޫ5'*蔇z>8Ջ~A92Ô93Wc>{ $7"nms~7jPX4ai{Qdy|ji8`+Ki_0 dyY;lBw_oD?E 9FI1ӹci|vY^+b$U~]AgՖ6HNdCaX9hEcpR'uC:qm_9w֫ČzvOEh];HK}p:kISOgDO{Zj )G^{C A F 'vE2*<'@.xWaH̒N5hm; rPioG30TcdJl܈(xS{簌Za1 ?e^2`:umm#ٺ2_,='skv5e" _[^X邿,F]~gtnYs)64 `Zrg }"2Cm*M3Is,XkH~:sv69֒Oaiej.|u?->#:`CkgJ_R葶ͪ{2'*kV":X2ǫ184.JH8{ibtkpsnbeim?鮲g+*(S:^uWk:dY\"&aMnV";J"ҳBOV" ZeӨH* E0 AWlaWOHxdp8'< 1p<:(WŧP0Y+B4 2m$s8{WO.gYZ{Eǜ0]bQ@{]+`(*/YXD赗_Z 194Nm9Z2SJڸ^:R6rƑkgR)M?LX"ys4L*nhdgb `ą-me9pE?.t2jyAlPN-;~#J[ոj)PJ] V4; :A*rg2Q#5n[qi]PYG~CbaMY(W+'vWz?Eu)X|+VUK 4J1{^!e Y@AYԠD"xEט 2,a@ےݽDt:vC偷D\cW9}5i8K$V5Y~ZZLg)9nmm{B{TkHw0 ^?\]B7wWW\6 /)_h}$yFC]|ϱӢK@okz-a ԽdKԧFuIC5DݒI{H Yw3Y6Y"<@{t˜Ե f=lo5{ϣǻ)a|19mu=LO3MJ?f.;'ӡHr6+ِSبzv`x=d ]r {0S$ݭhZD˫N=PXH0#_!c\ἎH"d8Au~mx6j_]/RmR^Ҭ5AKF`MQC 93ڡ.Y.?\őn}5APPԈ S잁оש/$ NجanZBhEcឱv;GgU ٵ"+T xvW<Ə/e -J,Z>纩2 ($))W 7j8=\Xr%*E@LgeUxꮼqʵ7\:8{*!4v`j[yz>Dy 'ߣNCZ0UA"?Ƕ~g(<)Pÿ8ҿ_.yq2)-`#e=ɴMJ`7<-_YiJ^;gO/W[ktsw+F`yօcs6?ݕ6i~76F[=BRm2죗Sjvw]GК b?7Y}U„`a/rR='꿶kvFGNkaSHYF9%"/l1BTٞ`H,Q ` C BU.~OD#WڼGٴypZ5a~ e٠eflC|R{Ijdn(:a 9[_PPUNp5OUEF!VpgSV;ft?l|23eV+6sI/rvKk(i4r^zIZ[l1 IEFYYYU-u\|@yQgi4 у!7NU(ĺv񾚇F)&/x ZJ7GY>DgkXO,GqG!MP 盥][Cq}T#x4& Eص1b_#:MQ쫉SSJQD{n>z镹 z/ 򹵵W!uMq15-ƭGOkK 5m7r§ *1- }}M}5I`2ȑް<."bJ[2x p ]O ξ7"K*c&>!DAbn,rE4*PR4 ~{Nq]9^w6<hmw8n}}r4'| o} ]@BC܏v=߫|o:PhRu#hK@^ӸU{-SeZF1Lu%.fPo5]f8:2F8ݾ%]쎳be+JQc+EVc%h"@ HwЊsMhy-bW^V1,$q%d! \A"^Yiz3rL~gzy+4¢Ͷx}qDuJ|i3ܒ~Dn#5ZOL?:f˂CP[cצHDr)ez ԞvU11/aCC ٛ->w#Mc*AXa ҥR,XprkyHBMkv}{- ,8B`㠥1Wϧm^xU 3^/F n(w멯-r#, c%$BuCg Y *w8Jr?P;f:u^p9mdĆvz'(t"L P9i4+@fF_־ZJqݳ3W'[ M 7\[T`H"йLO]L0g%*Jcu@UcbϢޟZ 1O_2}% 7{-Ug慙\]Wu/pOam2>K,RS#':S3]Rc[&^F0 =Y?#ZhVи> yץi({^N0I8ݷKkK\zoZYhalvчP]6wWeZ9^ 99Yݛgm[wDR+j)I'vr%˛ЧS $V+ "XsPv=Ыh|&# QwqW< g$W gd 2QtK0?$EGpwi<@43c'*r#hQ`8þR4Hg7 HςA?"Rv3R}wzD&7U܂v T.t HokY;!CJՂ+ QMxNѸ{ ߑAhs`3=A JمP+ɸeA4bdV7ʕ-DU^tA#slc@?xk \dp6< u6ڢ2"z48bϰ>;V|ѽ9;& 9Eis1Uhi)HwBV8{ۗ)D-8K_7P_7A#0ݎqRqӮoM-Q-WaX|7N˒ѩ70L_:KMxE.Z9ufʡ [g,:笾IIWȂ?/ګ)8`]Bo3lUa N"r7,J0*Ԯ&ԘK๜ A:S4 ٧x:BFBo.l ^*~޴~U٢V-lU%b^tYbX<<' ƽB+tv@nEDO8˨4ԃ?&ʜ TGFny]AB<2r]ܚy0*Dzyvqu$csF)*r dj:L]MPRx[na/RDZ_F7B 0ɺdžd_YR ;6F)[ebFݴR{(#-QbJ>:?Q6@J<A @ { }5^ag`!+PuljGO7gn^iX" 2;"yIiPdR{㘢.U3EYqn*Ko7=穙;WUfV ō`>=t{J&LO#έ\ K8"#U$Y!w# ^U.[b$VHt kyd\[m gR?x罞kәQ_ҿspA"n(9{#U:goQbD}ʂD7qOl0Fo{vCUtD.0$紀vyx٪rI&&]rB`A.nc0fCbf&87rOYz.O%u8xr\h ln_L&e{m$51ݓ^a,%+(KGlj =X̓keNQ`>+Rp`Ncoɨ~^|?|wG9b;gN֖:m*OAޙ@ϤB\7lI.iI]]>z WqO,nR,QgFw+_֩5gx"<ƆK M@{w;cGN{n\Oڵ] .57-a`lOܘ6 $t p+bI\Ǎ۔mBJ؎\m(%T3 h/t QD2!fp j:8m^ MENioSDE:KR=kA*xH))S|tYԎ?h19.D(\TB-#)0HK=7 Y9ތvc#Jd_hόZwŇJ VGTˮ+,Y &k3JxޓUI_3H ⃢n\3C933|,mNluc)0ձ "eq0x Oh lDgE_3l ,<2A܊ڃɴLB3ٌܑD Zx_T;c (+ؼ`[l6gT =YeѢRŬ[LH|w=53* psbTMxej%ӄY@+H$guѕpu5h<2v h7%ߚ8E>4L ud+tN=XoFΉS!S<iߦ4C9;>"c".kFUO7zbg":,4 Cu'&kW#J8姓G49;<.ܷ,yPRӟjhCJZ-^*[+mEya(MDHH9OϠKckDkPߞx@ Gpw6`Cp&SpC78o.MaRиFW.ew0-CaM4 c;ZMU, Ћ\Ad8O3k䩷{GhѨO%HRq{}nH'"`I:F +4}Y~-u4$co%G(ԯ1;u';!:*D=3Ku!7o*+L! G@pԑ?,?͙S9Mep:VT:eQD򰃒k6k˞iVArkHW塆fè s{Ơ1=gpcrY<7 cYe86sNZqXdEc^pz^RYO?՟ҥ+6Gf1'mxԤZu񹕔n\}e{EXǜK 7&d@c)([X{/&ԲHÏkDjkLxD΃QLΒ.&Ӊڀ @dªcB a݆# d>-$AW\!aYXgl,+W⼯LzO)) B_Etmq^0Z^ߦnvtΕq6dGBH:B2roA|_Qʁ#wSܐh>5h=S*Vrcяwʆm:/Ng =Rp2AϬsЍ`OawTpxzJ,kU % M<R# mkoAV9b]5+Q'0=K G_A"oap{`3;L$r?P5,* ^:U6Svl؉f.oAY;kI7 1{Wg{fL&UԓU`}zADn4ڢxzܑI,5* `T6*TLA^. ~uqT+^σmkXa5ies|~i51sYʘ[NAiw?r8l]ފ%6qc37h $J YZ